Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.41
PubTator Score 1.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count
Alzheimer's disease 644
Disease Target Count P-value
non-small cell lung carcinoma 413 1.53421817941443E-27
lung cancer 4473 6.97513558295891E-4
ductal carcinoma in situ 1745 0.00156293213972117
ovarian cancer 8492 0.00160825731640954
glioblastoma 5572 0.00616819952350907
Multiple myeloma 1328 0.00669911727282308
group 3 medulloblastoma 2254 0.0107731830183521
medulloblastoma, large-cell 6234 0.0129732692757217
ependymoma 2514 0.0257406883434079
Waldenstrons macroglobulinemia 765 0.0410273314076168

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.129 0.041
Multiple myeloma 1.244 0.007
ependymoma -1.300 0.026
glioblastoma 1.400 0.006
medulloblastoma, large-cell 1.200 0.013
non-small cell lung carcinoma 1.100 0.000
lung cancer 1.100 0.001
group 3 medulloblastoma 1.500 0.011
ductal carcinoma in situ 1.200 0.002
ovarian cancer 1.500 0.002

Synonym

Accession Q9Y6E2 A4D123 Q3B779 Q96JW5 Q9H3F7
Symbols MST017
HSPC028
MSTP017

Gene

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Fruitfly OMA Inparanoid

Pathway (1)

Gene RIF (4)

PMID Text
21745818 5MP1 (BZW2) acts as a partial mimic and competitor of eIF5, interfering with the key steps by which eIF5 regulates eIF2 function.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFD      1 - 70
ILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFL     71 - 140
KAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKA    141 - 210
NLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVK    211 - 280
EEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYC    281 - 350
YDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN     351 - 419
//

Text Mined References (25)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
23535033 2014 Genome-wide association study of the rate of cognitive decline in Alzheimer's disease.
21745818 2011 Mechanisms of translational regulation by a human eIF5-mimic protein.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...