Property Summary

NCBI Gene PubMed Count 19
PubMed Score 1.21
PubTator Score 1.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
ductal carcinoma in situ 1.200 1.6e-03
ependymoma -1.300 2.6e-02
glioblastoma 1.400 6.2e-03
group 3 medulloblastoma 1.500 1.1e-02
lung cancer 1.100 7.0e-04
medulloblastoma, large-cell 1.200 1.3e-02
Multiple myeloma 1.244 6.7e-03
non-small cell lung cancer 1.011 3.9e-15
ovarian cancer 1.500 1.6e-03
Waldenstrons macroglobulinemia 1.129 4.1e-02

Gene RIF (6)

AA Sequence

MNKHQKPVLTGQRFKTRKRDEKEKFEPTVFRDTLVQGLNEAGDDLEAVAKFLDSTGSRLDYRRYADTLFD      1 - 70
ILVAGSMLAPGGTRIDDGDKTKMTNHCVFSANEDHETIRNYAQVFNKLIRRYKYLEKAFEDEMKKLLLFL     71 - 140
KAFSETEQTKLAMLSGILLGNGTLPATILTSLFTDSLVKEGIAASFAVKLFKAWMAEKDANSVTSSLRKA    141 - 210
NLDKRLLELFPVNRQSVDHFAKYFTDAGLKELSDFLRVQQSLGTRKELQKELQERLSQECPIKEVVLYVK    211 - 280
EEMKRNDLPETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLAVFSSQGQSELILLQKVQEYC    281 - 350
YDNIHFMKAFQKIVVLFYKADVLSEEAILKWYKEAHVAKGKSVFLDQMKKFVEWLQNAEEESESEGEEN     351 - 419
//

Text Mined References (28)

PMID Year Title