Property Summary

Ligand Count 3
NCBI Gene PubMed Count 50
PubMed Score 132.95
PubTator Score 68.07

Knowledge Summary

Patent (36,691)

Expression

  Differential Expression (13)

Disease log2 FC p
dermatomyositis 1.100 3.2e-03
intraductal papillary-mucinous adenoma (... 1.300 1.2e-03
intraductal papillary-mucinous carcinoma... 1.100 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.200 6.3e-03
lung cancer -1.300 2.3e-03
Multiple myeloma 1.079 3.9e-03
osteosarcoma 1.159 2.0e-05
ovarian cancer -1.400 9.8e-05
pancreatic cancer 1.100 2.4e-02
pancreatic ductal adenocarcinoma liver m... 1.639 1.6e-02
psoriasis -1.400 5.1e-04
spina bifida -1.055 2.7e-02
Waldenstrons macroglobulinemia 1.220 6.5e-03

Gene RIF (20)

AA Sequence

MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE      1 - 70
EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI     71 - 140
LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDS    141 - 210
KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL    211 - 280
LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE    281 - 350
NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD    351 - 420
TMVAQLVQRLQRYSLSGGGTSSH                                                   421 - 443
//

Text Mined References (58)

PMID Year Title