Property Summary

NCBI Gene PubMed Count 46
Grant Count 142
R01 Count 110
Funding $14,632,281.57
PubMed Score 131.87
PubTator Score 68.07

Knowledge Summary

Patent (36,691)

Expression

Synonym

Accession Q9Y6E0 O14840 Q5JV92
Symbols MST3
STK3
MST3B
STE20
HEL-S-95

Gene

PDB

3A7F   3A7G   3A7H   3A7I   3A7J   3CKW   3CKX   3ZHP   4O27   4QML   4QMM   4QMN   4QMO   4QMP   4QMQ   4QMS   4QMT   4QMU   4QMV   4QMW   4QMX   4QMY   4QMZ   4QNA   4QO9   4U8Z   4W8D   4W8E  

  TechDev Info (1)

Gary Johnson 233 Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
25456499 This study demonistrated that MST3 kinase phosphorylates TAO1/2 to enable Myosin Va function in promoting spine synapse development.
23889253 This review notes that in the SOK1 and MST4 germinal center kinase III family of proteins, exon 1 encodes a 5' untranslated region, but this is not the case for MST3.
23296203 These data provide molecular understanding of the mechanism by which MO25 isoforms regulates the activity of STE20 family protein kinases.
22493453 results show that a STRADalpha-rac1-PAK1 pathway regulates cell polarity and invasion in LKB1-null cells. It also suggests that while the function of LKB1 and STRADalpha undoubtedly overlap, they may also have mutually exclusive roles
22229648 mechanism of regulation of MST3
21985334 Striatin orchestrates the regulation of Mst3 by PP2A.
21277991 Mst3 is up-regulated and plays an important role in hypoxia-induced apoptosis of human trophoblasts.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20174665 Screening in Jurkat T-cells with a short-hairpin-RNA (shRNA) library identifies serine/threonine kinase 24 STK24 is important for HIV-1 replication
20124694 five crystal structures of the catalytic domain of MST3 are presented, including a complex with ADP and manganese, a unique cofactor preferred by the enzyme, and a complex with adenine.
More...

AA Sequence

MDSRAQLWGLALNKRRATLPHPGGSTNLKADPEELFTKLEKIGKGSFGEVFKGIDNRTQKVVAIKIIDLE      1 - 70
EAEDEIEDIQQEITVLSQCDSPYVTKYYGSYLKDTKLWIIMEYLGGGSALDLLEPGPLDETQIATILREI     71 - 140
LKGLDYLHSEKKIHRDIKAANVLLSEHGEVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDS    141 - 210
KADIWSLGITAIELARGEPPHSELHPMKVLFLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKEL    211 - 280
LKHKFILRNAKKTSYLTELIDRYKRWKAEQSHDDSSSEDSDAETDGQASGGSDSGDWIFTIREKDPKNLE    281 - 350
NGALQPSDLDRNKMKDIPKRPFSQCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISD    351 - 420
TMVAQLVQRLQRYSLSGGGTSSH                                                   421 - 443
//

Publication (54)

PMID Year Title
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25456499 2014 MST3 kinase phosphorylates TAO1/2 to enable Myosin Va function in promoting spine synapse development.
25416956 2014 A proteome-scale map of the human interactome network.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23889253 2013 SOcK, MiSTs, MASK and STicKs: the GCKIII (germinal centre kinase III) kinases and their heterologous protein-protein interactions.
23722424 2013 GWAS of 126,559 individuals identifies genetic variants associated with educational attainment.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
More...