Property Summary

NCBI Gene PubMed Count 20
PubMed Score 26.60
PubTator Score 18.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 3.5e-06
ependymoma -1.300 4.4e-02
group 4 medulloblastoma -1.100 2.3e-04
medulloblastoma, large-cell -1.300 3.1e-04
osteosarcoma -1.609 3.4e-06
ovarian cancer -1.700 1.4e-08
pancreatic ductal adenocarcinoma liver m... -1.924 1.9e-03

Gene RIF (11)

AA Sequence

MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNP      1 - 70
PRRMGRINHLRGPSPPPMAGGUGR                                                   71 - 94
//

Text Mined References (24)

PMID Year Title