Property Summary

NCBI Gene PubMed Count 17
Grant Count 12
R01 Count 9
Funding $1,548,498.63
PubMed Score 24.69
PubTator Score 18.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (8)

PMID Text
26567579 overexpression of SelK can inhibit human cancer cell Matrigel adhesion and migration
25368151 IP3R palmitoylation is a critical regulator of Ca(2+) flux in immune cells and define a previously unidentified DHHC/Selk complex responsible for this process.
25117454 SelK reduces hydrophobic substrates, such as phospholipid hydroperoxides, which are known to damage cell membranes.
23133653 Polymorphisms in thioredoxin reductase and selenoprotein K genes and selenium status modulate risk of prostate cancer
22016385 Data suggest that SelK is involved in the Derlin-dependent ERAD of glycosylated misfolded proteins and that the function defined by the prototypic SelK is the widespread function of selenium in eukaryotes.
21220695 Human lymphocyte SelK colocalizes with endoplasmic reticulum biomarker KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum receptor.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16962588 SelK is a novel antioxidant in cardiomyocytes and is related to the regulation of cellular redox balance.

AA Sequence

MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNP      1 - 70
PRRMGRINHLRGPSPPPMAGGUGR                                                   71 - 94
//

Text Mined References (17)

PMID Year Title
26567579 2015 Overexpression of Selenoprotein SelK in BGC-823 Cells Inhibits Cell Adhesion and Migration.
25368151 2014 Stable expression and function of the inositol 1,4,5-triphosphate receptor requires palmitoylation by a DHHC6/selenoprotein K complex.
25117454 2014 Selenoprotein K form an intermolecular diselenide bond with unusually high redox potential.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23133653 2012 Polymorphisms in thioredoxin reductase and selenoprotein K genes and selenium status modulate risk of prostate cancer.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21220695 2011 Selenoprotein K knockout mice exhibit deficient calcium flux in immune cells and impaired immune responses.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20692228 2010 SelK is a novel ER stress-regulated protein and protects HepG2 cells from ER stress agent-induced apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...