Property Summary

NCBI Gene PubMed Count 39
PubMed Score 50.33
PubTator Score 17.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (29)

AA Sequence

MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGL      1 - 70
FTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHP     71 - 140
FHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDS    141 - 210
GVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSR    211 - 280
GNSLFFRKVPFGKTYCCDLKMLI                                                   281 - 303
//

Text Mined References (44)

PMID Year Title