Property Summary

NCBI Gene PubMed Count 38
Grant Count 6
Funding $1,941,634.33
PubMed Score 48.20
PubTator Score 17.02

Knowledge Summary

Patent

No data available

Expression

Gene RIF (28)

PMID Text
26827940 The BID-MTCH2 axis regulates the differentiation/apoptosis of stem cells and mitochondrial metabolism. (Review)
23744079 Data indicate that Mtch2 accelerated conformational change in membrane-bound tBid (Bid) enables it to activate Bax.
23266187 Compares and contrasts all the known human SLC25A* genes and includes functional information.
23229156 Results imply a regulatory role for TMEM18, BDNF, MTCH2 and NEGR1 in adipocyte differentiation and biology. In addition, we show a variation of MAF expression during adipogenesis, while NPC1, PTER and SH2B1 were not regulated.
22443470 Our study supports earlier reports of SH2B1 to be of importance in insulin sensitivity and, in addition, suggests potential roles of NEGR1 and MTCH2.
22416135 Molecular basis of the interaction between proapoptotic truncated BID (tBID) protein and mitochondrial carrier homologue 2 (MTCH2) protein
22190034 HIV-1 Vpr is identified to have a physical interaction with mitochondrial carrier 2 (MTCH2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22179955 Gene-treatment interactions were observed for short-term weight loss. (MTCH2 rs10838738, Plifestyle*SNP = 0.022)
21795451 MTCH2 may play a role in cellular processes underlying obesity
20877624 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGL      1 - 70
FTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHP     71 - 140
FHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDS    141 - 210
GVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSR    211 - 280
GNSLFFRKVPFGKTYCCDLKMLI                                                   281 - 303
//

Publication (43)

PMID Year Title
26827940 2016 BCL-2 family proteins as regulators of mitochondria metabolism.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24949972 2014 Programmed translational readthrough generates antiangiogenic VEGF-Ax.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23744079 2013 tBid undergoes multiple conformational changes at the membrane required for Bax activation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23266187 The mitochondrial transporter family SLC25: identification, properties and physiopathology.
23229156 2013 Functional relevance of genes implicated by obesity genome-wide association study signals for human adipocyte biology.
22443470 2012 The role of obesity-related genetic loci in insulin sensitivity.
22416135 2012 Molecular basis of the interaction between proapoptotic truncated BID (tBID) protein and mitochondrial carrier homologue 2 (MTCH2) protein: key players in mitochondrial death pathway.
More...