Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Nasopharynx carcinoma 18 4.112 2.1

Synonym

Accession Q9Y6C7
Symbols NAG7
ERR10
NAG-7
ERR-10
LMCD1DN
LOH3CR2A
NCRNA00312

 Compartment GO Term (0)

Gene RIF (6)

AA Sequence

MAHHSLNTFYIWHNNVLHTHLVFFLPHLLNQPFSRGSFLIWLLLCWNSWYHLRTLRRQANQANKLSMMLL      1 - 70
RVKQSPGTKLCHGDSELTSGLLAT                                                   71 - 94
//

Text Mined References (16)

PMID Year Title