Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.00
PubTator Score 4.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Nasopharynx carcinoma 18 4.328 2.2

Synonym

Accession Q9Y6C7
Symbols NAG7
ERR10
NAG-7
ERR-10
LMCD1DN
LOH3CR2A
NCRNA00312

Gene

 Compartment GO Term (0)

Gene RIF (4)

PMID Text
23529758 Expression of LINC00312 is negatively correlated with tumor size but positively correlated with lymph node metastasis in nasopharyngeal carcinoma.
19591174 NAG7 plays a potential role in promoting nasopharyngeal carcinoma invasion by regulation of ERalpha and the H-ras/p-c-Raf and JNK2/AP-1/MMP1 signaling pathways.
12918109 Expression levels of NAG-7, and BRD7 did not alter in gastric and colorectal cancers. NAG-7 and BRD7 genes may not play role in gastric and colorectal carcinogenesis.
12452030 NAG7 gene re-expression could inhibit overproliferation of NPC cell by delaying the progression of G1 into S in cell cycle and inducing cell apoptosis.

AA Sequence

MAHHSLNTFYIWHNNVLHTHLVFFLPHLLNQPFSRGSFLIWLLLCWNSWYHLRTLRRQANQANKLSMMLL      1 - 70
RVKQSPGTKLCHGDSELTSGLLAT                                                   71 - 94
//

Text Mined References (11)

PMID Year Title
24168098 2014 Transcriptome interrogation of human myometrium identifies differentially expressed sense-antisense pairs of protein-coding and long non-coding RNA genes in spontaneous labor at term.
23529758 2013 Expression of LINC00312, a long intergenic non-coding RNA, is negatively correlated with tumor size but positively correlated with lymph node metastasis in nasopharyngeal carcinoma.
19591174 2009 NAG7 promotes human nasopharyngeal carcinoma invasion through inhibition of estrogen receptor alpha and up-regulation of JNK2/AP-1/MMP1 pathways.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474036 2004 ERR-10: a new repressor in transcriptional signaling activation of estrogen receptor-alpha.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12918109 2003 Expression of tumor related genes NGX6, NAG-7, BRD7 in gastric and colorectal cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12452030 2002 Effects of NPC-associated gene NAG7 on cell cycle and apoptosis in nasopharyngeal carcinoma cells.
11780420 2001 Molecular cloning and characterization of NAG-7: a novel gene downregulated in human nasopharyngeal carcinoma.
More...