Property Summary

NCBI Gene PubMed Count 41
PubMed Score 36.31
PubTator Score 38.90

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (10)

Disease log2 FC p
adrenocortical carcinoma -1.013 4.9e-04
Astrocytoma, Pilocytic 1.300 4.3e-05
ependymoma 1.200 9.7e-04
gastric carcinoma 1.800 1.5e-02
glioblastoma 1.400 1.3e-03
osteosarcoma 2.730 2.0e-04
ovarian cancer -1.900 4.7e-07
pediatric high grade glioma 1.600 7.2e-03
psoriasis 1.800 1.4e-03
sonic hedgehog group medulloblastoma 1.800 2.1e-04

Gene RIF (18)

AA Sequence

MAPRTLWSCYLCCLLTAAAGAASYPPRGFSLYTGSSGALSPGGPQAQIAPRPASRHRNWCAYVVTRTVSC      1 - 70
VLEDGVETYVKYQPCAWGQPQCPQSIMYRRFLRPRYRVAYKTVTDMEWRCCQGYGGDDCAESPAPALGPA     71 - 140
SSTPRPLARPARPNLSGSSAGSPLSGLGGEGPGESEKVQQLEEQVQSLTKELQGLRGVLQGLSGRLAEDV    141 - 210
QRAVETAFNGRQQPADAAARPGVHETLNEIQHQLQLLDTRVSTHDQELGHLNNHHGGSSSSGGSRAPAPA    211 - 280
SAPPGPSEELLRQLEQRLQESCSVCLAGLDGFRRQQQEDRERLRAMEKLLASVEERQRHLAGLAVGRRPP    281 - 350
QECCSPELGRRLAELERRLDVVAGSVTVLSGRRGTELGGAAGQGGHPPGYTSLASRLSRLEDRFNSTLGP    351 - 420
SEEQEESWPGAPGGLSHWLPAARGRLEQLGGLLANVSGELGGRLDLLEEQVAGAMQACGQLCSGAPGEQD    421 - 490
SQVSEILSALERRVLDSEGQLRLVGSGLHTVEAAGEARQATLEGLQEVVGRLQDRVDAQDETAAEFTLRL    491 - 560
NLTAARLGQLEGLLQAHGDEGCGACGGVQEELGRLRDGVERCSCPLLPPRGPGAGPGVGGPSRGPLDGFS    561 - 630
VFGGSSGSALQALQGELSEVILSFSSLNDSLNELQTTVEGQGADLADLGATKDRIISEINRLQQEATEHA    631 - 700
TESEERFRGLEEGQAQAGQCPSLEGRLGRLEGVCERLDTVAGGLQGLREGLSRHVAGLWAGLRETNTTSQ    701 - 770
MQAALLEKLVGGQAGLGRRLGALNSSLQLLEDRLHQLSLKDLTGPAGEAGPPGPPGLQGPPGPAGPPGSP    771 - 840
GKDGQEGPIGPPGPQGEQGVEGAPAAPVPQVAFSAALSLPRSEPGTVPFDRVLLNDGGYYDPETGVFTAP    841 - 910
LAGRYLLSAVLTGHRHEKVEAVLSRSNQGVARVDSGGYEPEGLENKPVAESQPSPGTLGVFSLILPLQAG    911 - 980
DTVCVDLVMGQLAHSEEPLTIFSGALLYGDPELEHA                                      981 - 1016
//

Text Mined References (45)

PMID Year Title