Property Summary

NCBI Gene PubMed Count 19
Grant Count 32
R01 Count 14
Funding $2,495,830.34
PubMed Score 73.09
PubTator Score 50.30

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
25826777 Our data also suggest that Sar1B overexpression contributes to regulation of CHOL transport and metabolism by facilitating rapid uptake and transport of CHOL.
24338480 although Sar1A antagonizes the lipoprotein secretion-promoting activity of Sar1B, both isoforms modulate the expression of genes encoding cholesterol biosynthetic enzymes and the synthesis of cholesterol de novo.
22974979 the behavior of the human of Sar1A and Sar1B, a key component of the COPII family of vesicle coat proteins, was examined.
21836065 Sar1b expression may promote intestinal lipid transport with the involvement of the coat protein complex II network and the processing of SREBP-1c.
19846172 Variable phenotypic expression of chylomicron retention disease in a kindred carrying a mutation of the Sara2 gene.
18786134 muscular as well as cardiac abnormalities that could be related to the reported expression of SARA2 in these tissues
17945526 Five mutations in the SAR1B gene causing Anderson disease.
15943909 Sara2 is an important gene in processes involving erythroid cell proliferation and differentiation.
12692552 identify eight mutations in SARA2 that are associated with three severe disorders of fat malabsorption

AA Sequence

MSFIFDWIYSGFSSVLQFLGLYKKTGKLVFLGLDNAGKTTLLHMLKDDRLGQHVPTLHPTSEELTIAGMT      1 - 70
FTTFDLGGHVQARRVWKNYLPAINGIVFLVDCADHERLLESKEELDSLMTDETIANVPILILGNKIDRPE     71 - 140
AISEERLREMFGLYGQTTGKGSISLKELNARPLEVFMCSVLKRQGYGEGFRWMAQYID                141 - 198
//

Text Mined References (23)

PMID Year Title
25826777 2015 New Insights In Intestinal Sar1B GTPase Regulation and Role in Cholesterol Homeostasis.
24338480 2014 The endoplasmic reticulum coat protein II transport machinery coordinates cellular lipid secretion and cholesterol biosynthesis.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22974979 2012 Modulation of membrane rigidity by the human vesicle trafficking proteins Sar1A and Sar1B.
21836065 2011 Expression of Sar1b enhances chylomicron assembly and key components of the coat protein complex II system driving vesicle budding.
21269460 2011 Initial characterization of the human central proteome.
19846172 2010 Variable phenotypic expression of chylomicron retention disease in a kindred carrying a mutation of the Sara2 gene.
19274794 2009 Novel missense mutations of SAR1B gene in an infant with chylomicron retention disease.
18786134 2008 Anderson's disease (chylomicron retention disease): a new mutation in the SARA2 gene associated with muscular and cardiac abnormalities.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...