Property Summary

NCBI Gene PubMed Count 18
Grant Count 5
R01 Count 5
Funding $299,973.8
PubMed Score 69.22
PubTator Score 66.10

Knowledge Summary

Patent

No data available

Synonym

Accession Q9Y6B2 B2RD11 Q8N7I4 Q9BZT9
Symbols CRI1
EID-1
RBP21
PTD014
C15orf3
PNAS-22
IRO45620

Gene

Gene RIF (9)

PMID Text
26643909 EID1 can modulate adipose mesenchymal stem cells, inducing a brown/beige lineage.
26631746 SCF(FBXO21) polyubiquitylates EID1 both in vitro and in vivo and is required for the efficient degradation of EID1 in both cycling and quiescent cells.
26085330 The results suggest that EID1 is a bona fide substrate of FBXO21 and that the control of EID1 abundance by SCF(FBXO)(21) might affect the transcriptional repression activity of EID1.
24379397 An unexpected EID1-binding site on SHP is located at the N terminus of the receptor, where EID1 mimics helix H1 of the nuclear receptor ligand-binding domain.
24167073 Pcid2 is present in the CBP/p300-EID1 complex to control the switch balance of mouse and human embryonic stem cells through modulation of EID1 degradation.
22186421 This study demonstrated that overexpression of EID1 reduced hippocampal long-term potentiation and impaired spatial learning and memory function in the transgenic mice
20486779 miR-138 inhibited adipogenesis through targeting the nuclear receptor coregulator EID-1
19276448 Repression of E6 and E7 oncogenes results in restoration of pRb suppressor pathways and induced apoptosis in HPV16-positive oropharyngeal squamous cell cancer cell lines.
17559085 The role of EID1 in fibroblast biology and fibrosis is reported.

AA Sequence

MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPE      1 - 70
GKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTRE     71 - 140
PALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE                           141 - 187
//

Publication (20)

PMID Year Title
26643909 2016 Regulation of human subcutaneous adipocyte differentiation by EID1.
26631746 2015 Peptidic degron in EID1 is recognized by an SCF E3 ligase complex containing the orphan F-box protein FBXO21.
26085330 2015 FBXO21 mediates the ubiquitylation and proteasomal degradation of EID1.
24379397 2014 Structural insights into gene repression by the orphan nuclear receptor SHP.
24167073 2014 Pcid2 inactivates developmental genes in human and mouse embryonic stem cells to sustain their pluripotency by modulation of EID1 stability.
22186421 2012 Increased EID1 nuclear translocation impairs synaptic plasticity and memory function associated with pathogenesis of Alzheimer's disease.
20486779 2011 MicroRNA hsa-miR-138 inhibits adipogenic differentiation of human adipose tissue-derived mesenchymal stem cells through adenovirus EID-1.
19276448 2009 E6 and e7 gene silencing and transformed phenotype of human papillomavirus 16-positive oropharyngeal cancer cells.
18557765 2008 The Prader-Willi syndrome protein necdin interacts with the E1A-like inhibitor of differentiation EID-1 and promotes myoblast differentiation.
17559085 2007 The transcriptional coactivator and acetyltransferase p300 in fibroblast biology and fibrosis.
More...