Property Summary

NCBI Gene PubMed Count 18
PubMed Score 78.85
PubTator Score 66.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Mesothelioma 38 0.0 0.0
Disease Target Count P-value
lung adenocarcinoma 2716 2.2e-12
ovarian cancer 8519 1.1e-05
Multiple myeloma 1332 1.2e-05
psoriasis 6694 5.0e-03
Parkinson's disease 392 9.8e-03
colon cancer 1478 4.5e-02
Disease Target Count Z-score Confidence
Gastroschisis 11 3.379 1.7

Expression

  Differential Expression (6)

Disease log2 FC p
colon cancer -1.100 4.5e-02
lung adenocarcinoma -1.100 2.2e-12
Multiple myeloma 2.315 1.2e-05
ovarian cancer -2.200 1.1e-05
Parkinson's disease -1.300 9.8e-03
psoriasis -1.100 5.0e-03

Gene RIF (9)

AA Sequence

MSEMAELSELYEESSDLQMDVMPGEGDLPQMEVGSGSRELSLRPSRSGAQQLEEEGPMEEEEAQPMAAPE      1 - 70
GKRSLANGPNAGEQPGQVAGADFESEDEGEEFDDWEDDYDYPEEEQLSGAGYRVSAALEEADKMFLRTRE     71 - 140
PALDGGFQMHYEKTPFDQLAFIEELFSLMVVNRLTEELGCDEIIDRE                           141 - 187
//

Text Mined References (20)

PMID Year Title