Property Summary

NCBI Gene PubMed Count 10
Grant Count 23
R01 Count 17
Funding $1,488,312.42
PubMed Score 6.42
PubTator Score 16.32

Knowledge Summary


No data available


  Differential Expression (4)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.651 0.050
Breast cancer 2.500 0.028
ovarian cancer 2.500 0.000
dermatomyositis 1.100 0.001

 GO Function (1)

Gene RIF (2)

24886551 cis-acting regulatory polymorphisms acting on GNL3 and SPCS1 contribute to the OA association signal at chromosome 3p21, and these genes therefore merit further investigation.
24009510 SPCS1 plays a key role in the formation of the membrane-associated NS2-E2 complex via its interaction with NS2 and E2, which leads to a coordinating interaction between the structural and non-structural proteins

AA Sequence

RRHPLKWLPVQESSTDDKKPGERKIKRHAKNN                                           71 - 102

Text Mined References (15)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24886551 2014 Allelic expression analysis of the osteoarthritis susceptibility locus that maps to chromosome 3p21 reveals cis-acting eQTLs at GNL3 and SPCS1.
24023390 2013 Large-scale top-down proteomics of the human proteome: membrane proteins, mitochondria, and senescence.
24009510 2013 Signal peptidase complex subunit 1 participates in the assembly of hepatitis C virus through an interaction with E2 and NS2.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21269460 2011 Initial characterization of the human central proteome.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.