Property Summary

NCBI Gene PubMed Count 61
Grant Count 41
R01 Count 30
Funding $3,108,356.88
PubMed Score 66.00
PubTator Score 100.07

Knowledge Summary

Patent

No data available

Expression

Gene RIF (64)

PMID Text
26358780 hippocampal CYP46A1 protein and 24S-hydroxycholesterol levels were reduced in a mouse model of Alzheimer's Disease-like Tau neuropathology
25084760 under conditions of membrane cholesterol reduction by increased CYP46A1 expression, neurons increase isoprenoid synthesis and sGTPase prenylation. This leads to a reduction in liver X receptor activity
25017465 Human CYP46A1 oxidizes 7-dehydrocholesterol to 24-hydroxy-7-dehydrocholesterol and 25-hydroxy-7-dehydrocholesterol.
24924840 While there were no differences in cognitive performance between participants with and those without metabolic syndrome, ApoE and CYP46 genotypes did correlate with mental manipulation scores.
23792195 results of meta-analysis suggested that CYP46A1 rs754203 is a minor risk factor for Alzheimer's disease
23604141 To identify the determinants of tight azole binding to CYP46A1.
23288837 analysis of binding of the cyano- and fluoro-containing drug bicalutamide to cytochrome P450 46A1
23167762 A meta-analysis indicates that the CYP46 gene SNP rs754203 is not significantly associated with sporadic Alzheimer's disease susceptibility in Chinese Han populations.
23070465 An meta-analysis has successfully proved that CC genotype of the CYP46A1 T/C polymorphism could increase the risk of Alzheimer's disease.
22977134 The rs754203 C allele in the CYP46A1 gene may confer a higher risk for exudative age-related macular degeneration in patients who carry no risk alleles in the CFH and LOC387715 genes.
More...

AA Sequence

MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKK      1 - 70
YGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRV     71 - 140
IDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKP    141 - 210
LSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQIL    211 - 280
KAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRL    281 - 350
QYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA    351 - 420
PKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRG    421 - 490
WQPAPPPPPC                                                                491 - 500
//

Text Mined References (62)

PMID Year Title
26358780 2015 Cholesterol 24-hydroxylase defect is implicated in memory impairments associated with Alzheimer-like Tau pathology.
25084760 2015 Cholesterol 24S-Hydroxylase Overexpression Inhibits the Liver X Receptor (LXR) Pathway by Activating Small Guanosine Triphosphate-Binding Proteins (sGTPases) in Neuronal Cells.
25017465 2014 Oxidation of 7-dehydrocholesterol and desmosterol by human cytochrome P450 46A1.
24924840 2014 Effects of metabolic syndrome, apolipoprotein E, and CYP46 on cognition among Taiwanese Chinese.
23792195 2013 CYP46A1 intron-2T/C polymorphism and Alzheimer's disease: an updated meta-analysis of 16 studies including 3,960 cases and 3,828 controls.
23604141 2013 Antifungal Azoles: Structural Insights into Undesired Tight Binding to Cholesterol-Metabolizing CYP46A1.
23288837 2013 Binding of a cyano- and fluoro-containing drug bicalutamide to cytochrome P450 46A1: unusual features and spectral response.
23167762 2013 Association of CYP46 gene polymorphism with sporadic Alzheimer's disease in Chinese Han populations: a meta-analysis.
23070465 2013 CYP46A1 T/C polymorphism associated with the APOE ?4 allele increases the risk of Alzheimer's disease.
22977134 2012 Single nucleotide polymorphism in the cholesterol-24S-hydroxylase (CYP46A1) gene and its association with CFH and LOC387715 gene polymorphisms in age-related macular degeneration.
More...