Property Summary

NCBI Gene PubMed Count 64
PubMed Score 68.60
PubTator Score 100.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.900 1.8e-04
astrocytic glioma -2.000 1.9e-03
Astrocytoma, Pilocytic -2.300 1.4e-06
atypical teratoid / rhabdoid tumor -3.500 1.8e-08
ependymoma -2.500 4.3e-03
glioblastoma -3.300 3.8e-09
group 3 medulloblastoma -3.500 6.0e-05
intraductal papillary-mucinous adenoma (... -1.200 1.5e-03
intraductal papillary-mucinous neoplasm ... -1.200 1.6e-02
medulloblastoma, large-cell -4.700 1.4e-05
oligodendroglioma -1.700 1.8e-02
Pick disease -1.100 1.5e-03
primitive neuroectodermal tumor -3.200 1.6e-04

Gene RIF (67)

AA Sequence

MSPGLLLLGSAVLLAFGLCCTFVHRARSRYEHIPGPPRPSFLLGHLPCFWKKDEVGGRVLQDVFLDWAKK      1 - 70
YGPVVRVNVFHKTSVIVTSPESVKKFLMSTKYNKDSKMYRALQTVFGERLFGQGLVSECNYERWHKQRRV     71 - 140
IDLAFSRSSLVSLMETFNEKAEQLVEILEAKADGQTPVSMQDMLTYTAMDILAKAAFGMETSMLLGAQKP    141 - 210
LSQAVKLMLEGITASRNTLAKFLPGKRKQLREVRESIRFLRQVGRDWVQRRREALKRGEEVPADILTQIL    211 - 280
KAEEGAQDDEGLLDNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSKRYLDFEDLGRL    281 - 350
QYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA    351 - 420
PKPRFTYFPFSLGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRPRG    421 - 490
WQPAPPPPPC                                                                491 - 500
//

Text Mined References (65)

PMID Year Title