Property Summary

NCBI Gene PubMed Count 33
Grant Count 108
R01 Count 65
Funding $11,664,332.15
PubMed Score 86.97
PubTator Score 54.41

Knowledge Summary

Patent (1,731)

Expression

  Differential Expression (11)

Disease log2 FC p
glioblastoma -2.200 0.000
ependymoma -2.500 0.000
astrocytoma -1.200 0.017
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.100 0.014
primitive neuroectodermal tumor -2.700 0.000
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -2.200 0.000
subependymal giant cell astrocytoma -1.136 0.032
lung carcinoma 2.900 0.000
psoriasis -1.600 0.000

Synonym

Accession Q9Y698 Q2M1M1 Q5TGT3 Q9UGZ7
Symbols MRD10

Gene

  TechDev Info (2)

Jing-Ruey Yeh gRNA validated for zebrafish model
Susumu Tomita phenotype in mouse

Gene RIF (16)

PMID Text
26744192 A transient positive feedback mechanism between AMPAR and stargazin has implications for information processing in the brain, because it should allow activity-dependent facilitation of excitatory synaptic transmission through a postsynaptic mechanism.
25422502 The additional cleft closure and/or stabilization of the more closed-cleft states of the LBD is expected to translate to higher agonist efficacy and could contribute to the structural mechanism for stargazin modulation of AMPAR function.
23166629 Autoinactivation is a subunit and splice form dependent property of AMPA receptor-stargazin complexes, which involves structural rearrangements within the complex rather than any physical dissociation.
20688780 Susceptibility to chronic pain following nerve injury is genetically affected by CACNG2
19805317 Data show that S-nitrosylation of stargazin increases binding to the AMPAR subunit GluR1, causing increased surface expression of the AMPAR.
19543281 findings show stargazin demonstrates differential control of AMPA receptor subunit stability
19156168 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18571626 The genes CACNG2 might be vulnerability genes for neuropsychologically defined subgroups of schizophrenic patients.
18571626 Observational study of gene-disease association. (HuGE Navigator)
18408563 Stargazin polymorphisms may play a role in the response to lithium treatment.
More...

AA Sequence

MGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKKNEEVMTHSGLWRTCCLE      1 - 70
GNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVILLFMGGLCIAASEFYKTRHNIILSAGI     71 - 140
FFVSAGLSNIIGIIVYISANAGDPSKSDSKKNSYSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRA    141 - 210
TARATDYLQASAITRIPSYRYRYQRRSRSSSRSTEPSHSRDASPVGIKGFNTLPSTEISMYTLSRDPLKA    211 - 280
ATTPTATYNSDRDNSFLQVHNCIQKENKDSLHSNTANRRTTPV                               281 - 323
//

Text Mined References (34)

PMID Year Title
26744192 2016 Superactivation of AMPA receptors by auxiliary proteins.
25422502 2014 Stargazin promotes closure of the AMPA receptor ligand-binding domain.
23166629 2012 Autoinactivation of the stargazin-AMPA receptor complex: subunit-dependency and independence from physical dissociation.
21376300 2011 Excess of de novo deleterious mutations in genes associated with glutamatergic systems in nonsyndromic intellectual disability.
20805473 2010 Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.
20688780 2010 Susceptibility to chronic pain following nerve injury is genetically affected by CACNG2.
20219255 2010 TARPs differentially decorate AMPA receptors to specify neuropharmacology.
19805317 2009 S-nitrosylation of stargazin regulates surface expression of AMPA-glutamate neurotransmitter receptors.
19543281 2009 Roles of stargazin and phosphorylation in the control of AMPA receptor subcellular distribution.
19156168 2009 Pharmacogenetics of antipsychotic response in the CATIE trial: a candidate gene analysis.
More...