Property Summary

NCBI Gene PubMed Count 29
PubMed Score 46.27
PubTator Score 66.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.7e-06
medulloblastoma, large-cell 6241 2.1e-06
medulloblastoma 720 3.5e-05
ovarian cancer 8520 4.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Friedreich ataxia 24 6.182 3.1

Expression

  Differential Expression (4)

Disease log2 FC p
medulloblastoma -1.200 3.5e-05
medulloblastoma, large-cell -1.400 2.1e-06
osteosarcoma 1.349 1.7e-06
ovarian cancer 1.200 4.9e-05

Gene RIF (14)

AA Sequence

MLLRAAWRRAAVAVTAAPGPKPAAPTRGLRLRVGDRAPQSAVPADTAAAPEVGPVLRPLYMDVQATTPLD      1 - 70
PRVLDAMLPYLINYYGNPHSRTHAYGWESEAAMERARQQVASLIGADPREIIFTSGATESNNIAIKGVAR     71 - 140
FYRSRKKHLITTQTEHKCVLDSCRSLEAEGFQVTYLPVQKSGIIDLKELEAAIQPDTSLVSVMTVNNEIG    141 - 210
VKQPIAEIGRICSSRKVYFHTDAAQAVGKIPLDVNDMKIDLMSISGHKIYGPKGVGAIYIRRRPRVRVEA    211 - 280
LQSGGGQERGMRSGTVPTPLVVGLGAACEVAQQEMEYDHKRISKLSERLIQNIMKSLPDVVMNGDPKHHY    281 - 350
PGCINLSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEEVD    351 - 420
YTVEKCIQHVKRLREMSPLWEMVQDGIDLKSIKWTQH                                     421 - 457
//

Text Mined References (32)

PMID Year Title