Property Summary

NCBI Gene PubMed Count 51
PubMed Score 70.52
PubTator Score 48.29

Knowledge Summary

Patent (7,308)

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Osteoarthritis 184 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Weight Gain 100 0.0 0.0
Disease Target Count
Degenerative polyarthritis 115

Expression

  Differential Expression (34)

Disease log2 FC p
adult high grade glioma 1.500 1.7e-02
aldosterone-producing adenoma -1.470 2.2e-02
Amyotrophic lateral sclerosis 1.019 7.2e-04
astrocytic glioma 2.000 2.4e-03
Astrocytoma, Pilocytic 1.700 1.9e-03
atypical teratoid / rhabdoid tumor 1.600 4.0e-04
autosomal dominant Emery-Dreifuss muscul... 1.472 4.3e-03
Becker muscular dystrophy 1.873 2.3e-04
Breast cancer 2.600 3.4e-02
colon cancer -1.100 1.6e-03
Down syndrome 2.000 1.3e-03
Duchenne muscular dystrophy 2.202 1.5e-09
ependymoma 1.800 2.6e-02
glioblastoma 1.600 9.8e-04
group 4 medulloblastoma 1.300 2.1e-02
hereditary spastic paraplegia -1.006 3.0e-02
juvenile dermatomyositis 1.756 6.7e-11
limb girdle muscular dystrophy 2A 1.608 5.8e-06
lung adenocarcinoma -1.100 1.7e-09
lung cancer -1.300 6.4e-03
lung carcinoma -1.300 9.2e-15
malignant mesothelioma -1.800 6.1e-07
medulloblastoma, large-cell 2.700 2.0e-05
Multiple myeloma 1.024 3.5e-02
oligodendroglioma 1.700 1.3e-02
osteosarcoma 3.176 3.4e-05
ovarian cancer -2.500 2.5e-06
pancreatic cancer 1.200 2.3e-02
Polycystic ovary syndrome -1.746 4.9e-02
primary pancreatic ductal adenocarcinoma 1.167 3.8e-02
primitive neuroectodermal tumor 1.200 7.0e-03
progressive supranuclear palsy -1.700 5.3e-03
pterygium 1.100 1.5e-02
tuberculosis and treatment for 3 months -1.300 1.3e-04

Protein-protein Interaction (5)

Gene RIF (27)

AA Sequence

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA      1 - 70
PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL     71 - 140
ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI    141 - 210
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK                               211 - 253
//

Text Mined References (61)

PMID Year Title