Property Summary

NCBI Gene PubMed Count 50
Grant Count 27
R01 Count 22
Funding $5,285,227.79
PubMed Score 65.24
PubTator Score 48.29

Knowledge Summary

Patent (7,308)

Expression

Gene RIF (26)

PMID Text
26445368 in malignant pleural mesothelioma, the gene expressions of CLIC3 and CLIC4 were significantly increased compared to controls
25546839 CLIC1 and CLIC4 are overexpressed in specific tumor types or their corresponding stroma and change localization and function from hydrophilic cytosolic to integral transmembrane proteins. (Review)
25344254 CLIC4 knockdown decreases cell-matrix adhesion, cell spreading and integrin signaling, whereas it increases cell motility.
24916695 CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer.
24503951 Increased CLIC4 expression is an early manifestation and mediator of endothelial dysfunction in pulmonary hypertension.
24503901 This study investigated the proteome modulated by oncogenic KRAS in immortalized airway epithelial cells.
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
23416981 CLIC4 increases tumor cell migration and invasion in a TGF-beta-dependent manner.
23380911 Our data indicate that CLIC4 protein may be a key element in the apoptotic response to oxidative stress.
22761775 These results demonstrate that CLIC4 nuclear translocation is an integral part of the cellular response to starvation.
More...

AA Sequence

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA      1 - 70
PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL     71 - 140
ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI    141 - 210
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK                               211 - 253
//

Text Mined References (60)

PMID Year Title
26445368 2015 Transcriptional over-expression of chloride intracellular channels 3 and 4 in malignant pleural mesothelioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25546839 2015 Chloride channels in cancer: Focus on chloride intracellular channel 1 and 4 (CLIC1 AND CLIC4) proteins in tumor development and as novel therapeutic targets.
25344254 2014 CLIC4 regulates cell adhesion and ?1 integrin trafficking.
24916695 2014 CLIC4, ERp29, and Smac/DIABLO derived from metastatic cancer stem-like cells stratify prognostic risks of colorectal cancer.
24503951 2014 Aberrant chloride intracellular channel 4 expression contributes to endothelial dysfunction in pulmonary arterial hypertension.
24503901 2014 Proteome analysis for downstream targets of oncogenic KRAS--the potential participation of CLIC4 in carcinogenesis in the lung.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23792823 2013 Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer.
23416981 2014 CLIC4 regulates TGF-?-dependent myofibroblast differentiation to produce a cancer stroma.
More...