Property Summary

NCBI Gene PubMed Count 50
PubMed Score 65.24
PubTator Score 48.29

Knowledge Summary

Patent (7,308)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
lung carcinoma 2844 9.21480066636449E-15
juvenile dermatomyositis 1189 6.72954869454744E-11
Duchenne muscular dystrophy 602 1.51934434721185E-9
lung adenocarcinoma 2714 1.73054668191205E-9
malignant mesothelioma 3163 6.13661504593677E-7
posterior fossa group A ependymoma 1511 1.96129075045736E-6
ovarian cancer 8492 2.48647950113294E-6
glioblastoma 5572 5.14527731406804E-6
medulloblastoma, large-cell 6234 2.00250348698778E-5
osteosarcoma 7933 3.38490209760036E-5
limb girdle muscular dystrophy 2B 74 4.46799879887782E-5
pediatric high grade glioma 2712 5.10593922330698E-5
lung cancer 4473 8.07733865821576E-5
tuberculosis and treatment for 3 months 327 1.26361493192132E-4
Becker muscular dystrophy 187 2.34123858933872E-4
atypical teratoid / rhabdoid tumor 4369 3.995863305104E-4
Amyotrophic Lateral Sclerosis 432 7.20191488240874E-4
Down syndrome 548 0.00125596786264328
colon cancer 1475 0.00160168861854777
pilocytic astrocytoma 3086 0.00161266776397667
astrocytic glioma 2241 0.00237849231526629
medulloblastoma 1524 0.00311669946145254
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00433157000125405
progressive supranuclear palsy 674 0.00526119667708599
primitive neuroectodermal tumor 3031 0.00696422193742097
oligodendroglioma 2849 0.0133828658842016
pterygium 74 0.0147762119270652
aldosterone-producing adenoma 664 0.0222005250728182
pancreatic cancer 2300 0.0227769366874194
hereditary spastic paraplegia 313 0.0300924195495392
Breast cancer 3099 0.0343362226277109
Multiple myeloma 1328 0.0354580802756358
primary pancreatic ductal adenocarcinoma 1271 0.0382260799928133
Polycystic Ovary Syndrome 335 0.0489789633373163
Disease Target Count Z-score Confidence
hepatocellular carcinoma 550 3.84 1.9
Borna disease 8 3.188 1.6

Expression

Synonym

Accession Q9Y696 Q9UFW9 Q9UQJ6
Symbols H1
huH1
p64H1
CLIC4L
MTCLIC

Gene

PDB

2AHE   2D2Z   3OQS  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Pathway (1)

Gene RIF (26)

PMID Text
26445368 in malignant pleural mesothelioma, the gene expressions of CLIC3 and CLIC4 were significantly increased compared to controls
25546839 CLIC1 and CLIC4 are overexpressed in specific tumor types or their corresponding stroma and change localization and function from hydrophilic cytosolic to integral transmembrane proteins. (Review)
25344254 CLIC4 knockdown decreases cell-matrix adhesion, cell spreading and integrin signaling, whereas it increases cell motility.
24916695 CLIC4, ERp29, and Smac/DIABLO integrated into a novel panel based on cancer stem-like cells in association with metastasis stratify the prognostic risks of colorectal cancer.
24503951 Increased CLIC4 expression is an early manifestation and mediator of endothelial dysfunction in pulmonary hypertension.
24503901 This study investigated the proteome modulated by oncogenic KRAS in immortalized airway epithelial cells.
23792823 In addition to CLIC1 and TPM1, which were the proteins initially discovered in a xenograft mouse model, CLIC4, TPM2, TPM3, and TPM4 were present in ovarian cancer patient sera at significantly elevated levels compared with controls.
23416981 CLIC4 increases tumor cell migration and invasion in a TGF-beta-dependent manner.
23380911 Our data indicate that CLIC4 protein may be a key element in the apoptotic response to oxidative stress.
22761775 These results demonstrate that CLIC4 nuclear translocation is an integral part of the cellular response to starvation.
More...

AA Sequence

MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA      1 - 70
PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL     71 - 140
ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI    141 - 210
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK                               211 - 253
//

Text Mined References (60)

PMID Year Title
26445368 2015 Transcriptional over-expression of chloride intracellular channels 3 and 4 in malignant pleural mesothelioma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25546839 2015 Chloride channels in cancer: Focus on chloride intracellular channel 1 and 4 (CLIC1 AND CLIC4) proteins in tumor development and as novel therapeutic targets.
25344254 2014 CLIC4 regulates cell adhesion and ?1 integrin trafficking.
24916695 2014 CLIC4, ERp29, and Smac/DIABLO derived from metastatic cancer stem-like cells stratify prognostic risks of colorectal cancer.
24503951 2014 Aberrant chloride intracellular channel 4 expression contributes to endothelial dysfunction in pulmonary arterial hypertension.
24503901 2014 Proteome analysis for downstream targets of oncogenic KRAS--the potential participation of CLIC4 in carcinogenesis in the lung.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23792823 2013 Protein isoform-specific validation defines multiple chloride intracellular channel and tropomyosin isoforms as serological biomarkers of ovarian cancer.
23416981 2014 CLIC4 regulates TGF-?-dependent myofibroblast differentiation to produce a cancer stroma.
More...