Property Summary

NCBI Gene PubMed Count 22
PubMed Score 131.03
PubTator Score 40.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 8.8e-07
adult high grade glioma 3801 8.8e-04
Disease Target Count Z-score Confidence
Gout 104 0.0 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 8.8e-04
psoriasis -1.700 8.8e-07

Gene RIF (13)

AA Sequence

MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLP      1 - 70
REPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ     71 - 140
KGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALA    141 - 210
GFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPE    211 - 280
SARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCC    281 - 350
VVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR    351 - 420
LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVW    421 - 490
LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEEMPMKQVQN                491 - 548
//

Text Mined References (27)

PMID Year Title