Tbio | Solute carrier family 22 member 7 |
Mediates sodium-independent multispecific organic anion transport. Transport of prostaglandin E2, prostaglandin F2, tetracycline, bumetanide, estrone sulfate, glutarate, dehydroepiandrosterone sulfate, allopurinol, 5-fluorouracil, paclitaxel, L-ascorbic acid, salicylate, ethotrexate, and alpha-ketoglutarate.
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]
Comments
Disease | log2 FC | p |
---|---|---|
adult high grade glioma | -1.100 | 0.001 |
psoriasis | -1.700 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG |
Horse | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG Inparanoid |
Opossum | OMA EggNOG Inparanoid |
Platypus | OMA EggNOG Inparanoid |
Chicken | OMA Inparanoid |
PMID | Text |
---|---|
26377792 | suggest that OAT2-mediated cGMP uptake does not occur via exchange with monocarboxylates, dicarboxylates, and hydroxyl ions |
26230641 | Two novel variants in SLC22A17 and SLC22A7 were significantly associated with anthracycline-induced cardiotoxicity. |
25904762 | the findings revealed the important role of OAT2 in renal secretion and possible reabsorption of creatinine and suggested a molecular basis for potential species difference in the transporter handling of creatinine |
24646860 | At physiologic creatinine concentrations, specific activity of OAT2 transport was over twofold higher than OCT2 or OCT3, establishing OAT2 as a likely creatinine transporter, challenging the view that creatinine is solely transported by a cationic pathway |
23543312 | mitochondrial pathways may affect SLC 22A7 function to promote the occurrence of hepatocellular carcinoma |
22981274 | Benzoic acid and specific 2-oxo acids activate hepatic efflux of glutamate at OAT2 |
22190696 | Transport of the antivirals into human embryonic kidney cells was stimulated 10- to 20-fold by expression of OAT2. |
21446918 | Expression of rat OAT2 in HEK (human embryonic kidney)-293 cells stimulates accumulation of zwitterion trigonelline; subsequently, orotic acid is identified as an excellent and specific substrate of OAT2 from human. |
19854166 | results suggest that genetic polymorphisms may not be a significant contributing factor to variations in the hOAT2 expression or hOAT2 transport activity |
19343046 | Observational study of gene-disease association. (HuGE Navigator) |
More... |
MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLP 1 - 70 REPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ 71 - 140 KGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALA 141 - 210 GFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPE 211 - 280 SARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCC 281 - 350 VVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR 351 - 420 LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVW 421 - 490 LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEEMPMKQVQN 491 - 548 //
PMID | Year | Title |
---|---|---|
26377792 | 2015 | Human organic anion transporter 2 is distinct from organic anion transporters 1 and 3 with respect to transport function. |
26230641 | 2015 | Genetic variants in SLC22A17 and SLC22A7 are associated with anthracycline-induced cardiotoxicity in children. |
25904762 | 2015 | Characterization of Organic Anion Transporter 2 (SLC22A7): A Highly Efficient Transporter for Creatinine and Species-Dependent Renal Tubular Expression. |
24646860 | 2014 | Contribution of the organic anion transporter OAT2 to the renal active tubular secretion of creatinine and mechanism for serum creatinine elevations caused by cobicistat. |
23543312 | 2014 | Mitochondrial metabolism in the noncancerous liver determine the occurrence of hepatocellular carcinoma: a prospective study. |
23263486 | 2013 | Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. |
22981274 | 2013 | Benzoic acid and specific 2-oxo acids activate hepatic efflux of glutamate at OAT2. |
22190696 | 2012 | Expression of organic anion transporter 2 in the human kidney and its potential role in the tubular secretion of guanine-containing antiviral drugs. |
21446918 | 2011 | OAT2 catalyses efflux of glutamate and uptake of orotic acid. |
19854166 | 2010 | Identification of genetic polymorphisms of human OAT1 and OAT2 genes and their relationship to hOAT2 expression in human liver. |
More... |