Property Summary

NCBI Gene PubMed Count 21
Grant Count 39
R01 Count 31
Funding $2,241,821.95
PubMed Score 122.75
PubTator Score 40.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
adult high grade glioma -1.100 0.001
psoriasis -1.700 0.000

Gene RIF (12)

PMID Text
26377792 suggest that OAT2-mediated cGMP uptake does not occur via exchange with monocarboxylates, dicarboxylates, and hydroxyl ions
26230641 Two novel variants in SLC22A17 and SLC22A7 were significantly associated with anthracycline-induced cardiotoxicity.
25904762 the findings revealed the important role of OAT2 in renal secretion and possible reabsorption of creatinine and suggested a molecular basis for potential species difference in the transporter handling of creatinine
24646860 At physiologic creatinine concentrations, specific activity of OAT2 transport was over twofold higher than OCT2 or OCT3, establishing OAT2 as a likely creatinine transporter, challenging the view that creatinine is solely transported by a cationic pathway
23543312 mitochondrial pathways may affect SLC 22A7 function to promote the occurrence of hepatocellular carcinoma
22981274 Benzoic acid and specific 2-oxo acids activate hepatic efflux of glutamate at OAT2
22190696 Transport of the antivirals into human embryonic kidney cells was stimulated 10- to 20-fold by expression of OAT2.
21446918 Expression of rat OAT2 in HEK (human embryonic kidney)-293 cells stimulates accumulation of zwitterion trigonelline; subsequently, orotic acid is identified as an excellent and specific substrate of OAT2 from human.
19854166 results suggest that genetic polymorphisms may not be a significant contributing factor to variations in the hOAT2 expression or hOAT2 transport activity
19343046 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGFEELLEQVGGFGPFQLRNVALLALPRVLLPLHFLLPIFLAAVPAHRCALPGAPANFSHQDVWLEAHLP      1 - 70
REPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDHSEFSSTIATESQWDLVCEQ     71 - 140
KGLNRAASTFFFAGVLVGAVAFGYLSDRFGRRRLLLVAYVSTLVLGLASAASVSYVMFAITRTLTGSALA    141 - 210
GFTIIVMPLELEWLDVEHRTVAGVLSSTFWTGGVMLLALVGYLIRDWRWLLLAVTLPCAPGILSLWWVPE    211 - 280
SARWLLTQGHVKEAHRYLLHCARLNGRPVCEDSFSQEAVSKVAAGERVVRRPSYLDLFRTPRLRHISLCC    281 - 350
VVVWFGVNFSYYGLSLDVSGLGLNVYQTQLLFGAVELPSKLLVYLSVRYAGRRLTQAGTLLGTALAFGTR    351 - 420
LLVSSDMKSWSTVLAVMGKAFSEAAFTTAYLFTSELYPTVLRQTGMGLTALVGRLGGSLAPLAALLDGVW    421 - 490
LSLPKLTYGGIALLAAGTALLLPETRQAQLPETIQDVERKSAPTSLQEEEMPMKQVQN                491 - 548
//

Text Mined References (26)

PMID Year Title
26377792 2015 Human organic anion transporter 2 is distinct from organic anion transporters 1 and 3 with respect to transport function.
26230641 2015 Genetic variants in SLC22A17 and SLC22A7 are associated with anthracycline-induced cardiotoxicity in children.
25904762 2015 Characterization of Organic Anion Transporter 2 (SLC22A7): A Highly Efficient Transporter for Creatinine and Species-Dependent Renal Tubular Expression.
24646860 2014 Contribution of the organic anion transporter OAT2 to the renal active tubular secretion of creatinine and mechanism for serum creatinine elevations caused by cobicistat.
23543312 2014 Mitochondrial metabolism in the noncancerous liver determine the occurrence of hepatocellular carcinoma: a prospective study.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
22981274 2013 Benzoic acid and specific 2-oxo acids activate hepatic efflux of glutamate at OAT2.
22190696 2012 Expression of organic anion transporter 2 in the human kidney and its potential role in the tubular secretion of guanine-containing antiviral drugs.
21446918 2011 OAT2 catalyses efflux of glutamate and uptake of orotic acid.
19854166 2010 Identification of genetic polymorphisms of human OAT1 and OAT2 genes and their relationship to hOAT2 expression in human liver.
More...