Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.66
PubTator Score 3.06

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (29)

Disease log2 FC p
acute myeloid leukemia -1.400 3.6e-02
adrenocortical carcinoma -1.044 3.1e-02
Atopic dermatitis -1.100 6.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.771 5.0e-03
Breast cancer -1.200 7.8e-05
breast carcinoma -1.600 1.9e-05
dermatomyositis 1.200 2.1e-02
Duchenne muscular dystrophy 1.767 8.3e-07
ductal carcinoma in situ -1.300 6.5e-04
fibroadenoma -1.200 9.7e-04
group 4 medulloblastoma -1.200 4.6e-03
intraductal papillary-mucinous adenoma (... -3.900 1.5e-05
intraductal papillary-mucinous carcinoma... -3.700 8.5e-05
intraductal papillary-mucinous neoplasm ... -3.500 1.7e-03
invasive ductal carcinoma -2.600 1.1e-04
juvenile dermatomyositis 1.532 2.4e-09
limb girdle muscular dystrophy 2A 1.024 9.2e-03
lung adenocarcinoma -1.700 2.2e-11
lung cancer -1.500 7.4e-05
malignant mesothelioma -1.500 7.7e-07
medulloblastoma, large-cell -2.100 1.0e-04
non-small cell lung cancer -1.653 1.7e-21
ovarian cancer -2.500 4.3e-06
pancreatic cancer 1.400 4.4e-03
pituitary cancer -1.400 3.5e-04
primary pancreatic ductal adenocarcinoma 1.521 2.1e-03
primary Sjogren syndrome 1.100 8.0e-04
psoriasis -1.200 4.4e-04
ulcerative colitis 2.000 5.1e-05

Gene RIF (2)

AA Sequence

MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGR      1 - 70
YASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYP     71 - 140
LGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY              141 - 200
//

Text Mined References (11)

PMID Year Title