Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.50
PubTator Score 3.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 3.91026685870618E-31
non-small cell lung cancer 2798 1.74062270945889E-21
lung adenocarcinoma 2714 1.78922874728751E-17
juvenile dermatomyositis 1189 2.39072052427008E-9
malignant mesothelioma 3163 7.68708842578413E-7
Duchenne muscular dystrophy 602 8.27199036929048E-7
ovarian cancer 8492 4.26517539958634E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 1.50396714162669E-5
ulcerative colitis 2087 5.05483395481271E-5
lung cancer 4473 7.36958671824544E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 8.50642253467889E-5
medulloblastoma, large-cell 6234 1.00455095039894E-4
invasive ductal carcinoma 2950 1.13005085272518E-4
pituitary cancer 1972 3.5195836066432E-4
non-inflammatory breast cancer 208 6.27255812865658E-4
ductal carcinoma in situ 1745 6.45207570539275E-4
primary Sjogren syndrome 789 7.95588421922437E-4
fibroadenoma 557 9.71810348724912E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00172584651666636
primary pancreatic ductal adenocarcinoma 1271 0.00213603885374734
pancreatic cancer 2300 0.0044171847999293
group 4 medulloblastoma 1875 0.00455554540158523
psoriasis 6685 0.00487775658607605
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00501863190161253
Atopic dermatitis 944 0.00665847749727514
limb girdle muscular dystrophy 2A 156 0.00917426914353442
dermatomyositis 967 0.0209718580782896
adrenocortical carcinoma 1427 0.0310018878669695
acute myeloid leukemia 785 0.0355493856685278
Disease Target Count Z-score Confidence
Lipoma 19 4.294 2.1
Chondroma 12 3.774 1.9

Expression

Synonym

Accession Q9Y693 B2R7M2 Q53FC0 Q96SH5
Symbols

Gene

Gene RIF (2)

PMID Text
22538188 Amplification of the LHFP gene is associated with mesenchymal differentiation in gliosarcoma.
15905332 The authors present an overview of the LHFP gene family in mouse and humans

AA Sequence

MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGR      1 - 70
YASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYP     71 - 140
LGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY              141 - 200
//

Text Mined References (11)

PMID Year Title
23551011 2013 Genome-wide association study of pre-eclampsia detects novel maternal single nucleotide polymorphisms and copy-number variants in subsets of the Hyperglycemia and Adverse Pregnancy Outcome (HAPO) study cohort.
22745009 2012 Multiple loci influencing hippocampal degeneration identified by genome scan.
22538188 2012 Amplification of the STOML3, FREM2, and LHFP genes is associated with mesenchymal differentiation in gliosarcoma.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15905332 2005 A missense mutation in the previously undescribed gene Tmhs underlies deafness in hurry-scurry (hscy) mice.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10329012 1999 LHFP, a novel translocation partner gene of HMGIC in a lipoma, is a member of a new family of LHFP-like genes.
More...