Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.65
PubTator Score 8.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia 1.200 3.9e-02
atypical teratoid / rhabdoid tumor 1.100 9.3e-06
group 3 medulloblastoma 2.200 1.0e-06
medulloblastoma, large-cell 1.100 1.4e-04
osteosarcoma -1.766 2.1e-08
ovarian cancer -1.200 7.5e-08
primitive neuroectodermal tumor 1.100 6.9e-04
psoriasis 1.300 5.5e-03

Gene RIF (5)

AA Sequence

MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGLFIDGHFYNRIYEAGSENNTAVVAVET      1 - 70
HTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKS     71 - 140
TLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADG    141 - 210
SITQIAISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEI    211 - 280
EELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQK    281 - 350
KQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMG    351 - 420
NIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTT    421 - 490
MVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQ    491 - 560
HQVHNVEIVVLED                                                             561 - 573
//

Text Mined References (21)

PMID Year Title