Property Summary

NCBI Gene PubMed Count 19
PubMed Score 7.66
PubTator Score 8.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.00685506183913E-8
group 3 medulloblastoma 2254 1.034163867755E-6
atypical teratoid / rhabdoid tumor 4369 9.26567245678013E-6
ovarian cancer 8492 1.88178529012431E-5
medulloblastoma, large-cell 6234 1.44669660104412E-4
primitive neuroectodermal tumor 3031 6.90097257816146E-4
psoriasis 6685 0.00553772275184012
acute myeloid leukemia 785 0.0387058112335379
Disease Target Count Z-score Confidence
Blepharophimosis 17 3.976 2.0

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.300 0.006
osteosarcoma -2.684 0.000
group 3 medulloblastoma 2.200 0.000
atypical teratoid / rhabdoid tumor 1.100 0.000
medulloblastoma, large-cell 1.100 0.000
primitive neuroectodermal tumor 1.100 0.001
acute myeloid leukemia 1.200 0.039
ovarian cancer 1.700 0.000

Synonym

Accession Q9Y692 B1AT48 Q9NWH1 Q9UKD0 GMEB-1
Symbols PIF96
P96PIF

Gene

PDB

1OQJ  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
18455874 GMEB1 effectively attenuated caspase activation and apoptosis caused by these stresses in human neuroblastoma SK-N-MC cells, indicating that it functions as a potent inhibitor of caspase activation and apoptosis in response to oxidative stress.
16497673 GMEB1 is an endogenous regulator that selectively binds to initiator procaspases and inhibits caspase-induced apoptosis
15555560 GMEB1 is capable of binding to the prodomain of caspase-2; findings indicated that GMEB1 might be an endogenous inhibitory protein that selectively interacts with prodomain of caspase-2 to disrupt the autoactivation
12702733 1.55 A resolution crystal structure of a central portion of GMEB1, encompassing its SAND domain
11743720 consensus DNA recognition motif for two KDWK transcription factors identifies flexible-length, CpG-methylation sensitive cognate binding sites in the majority of human promoters

AA Sequence

MANAEVSVPVGDVVVVPTEGNEGENPEDTKTQVILQLQPVQQGLFIDGHFYNRIYEAGSENNTAVVAVET      1 - 70
HTIHKIEEGIDTGTIEANEDMEIAYPITCGESKAILLWKKFVCPGINVKCVKFNDQLISPKHFVHLAGKS     71 - 140
TLKDWKRAIRLGGIMLRKMMDSGQIDFYQHDKVCSNTCRSTKFDLLISSARAPVPGQQTSVVQTPTSADG    141 - 210
SITQIAISEESMEEAGLEWNSALTAAVTMATEEGVKKDSEEISEDTLMFWKGIADVGLMEEVVCNIQKEI    211 - 280
EELLRGVQQRLIQAPFQVTDAAVLNNVAHTFGLMDTVKKVLDNRRNQVEQGEEQFLYTLTDLERQLEEQK    281 - 350
KQGQDHRLKSQTVQNVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMG    351 - 420
NIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSSAKSSSPDTVTIHPSSSLALLSSTAMQDGSTLGNMTT    421 - 490
MVSPVELVAMESGLTSAIQAVESTSEDGQTIIEIDPAPDPEAEDTEGKAVILETELRTEEKVVAEMEEHQ    491 - 560
HQVHNVEIVVLED                                                             561 - 573
//

Text Mined References (21)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18455874 2008 GMEB1, a novel endogenous caspase inhibitor, prevents hypoxia- and oxidative stress-induced neuronal apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16497673 2006 Glucocorticoid modulatory element-binding protein 1 binds to initiator procaspases and inhibits ischemia-induced apoptosis and neuronal injury.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15555560 2004 Regulation of procaspase-2 by glucocorticoid modulatory element-binding protein 1 through the interaction with caspase recruitment domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
More...