Property Summary

NCBI Gene PubMed Count 7
PubMed Score 18.76
PubTator Score 4.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 2.77551072483999E-10
ovarian cancer 8492 2.90838286750204E-7
medulloblastoma, large-cell 6234 1.40440909866146E-6
Pick disease 1893 1.52908541225741E-6
psoriasis 6685 1.25441445280618E-5
tuberculosis and treatment for 6 months 686 9.38140310388513E-5
Atopic dermatitis 944 0.00304423196642751
atypical teratoid / rhabdoid tumor 4369 0.00334274864673354
Multiple myeloma 1328 0.0171976811194375
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0345439112468181
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0425862045224045
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0447561889398629
Breast cancer 3099 0.0455745163521866
oligodendroglioma 2849 0.046560188265267
Disease Target Count Z-score Confidence
Prostate carcinoma in situ 11 4.714 2.4

Expression

Synonym

Accession Q9Y689 Q580I5
Symbols ARL5
ARFLP5

Gene

PDB

1Z6Y   1ZJ6   2H16   2H17  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (4)

PMID Text
25496667 Genome-wide shRNA screening identifies ARL5A, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24327274 microRNA-202-3p inhibits cell proliferation by targeting ADP-ribosylation factor-like 5A in human colorectal carcinoma.
15896705 crystal structure
12414990 developmentally regulated ARL5, with its distinctive nuclear/nucleolar localization and interaction with HP1alpha, may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development

AA Sequence

MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ      1 - 70
ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ     71 - 140
FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR                                   141 - 179
//

Text Mined References (9)

PMID Year Title
24327274 2014 microRNA-202-3p inhibits cell proliferation by targeting ADP-ribosylation factor-like 5A in human colorectal carcinoma.
15896705 2005 2.0 A crystal structure of human ARL5-GDP3'P, a novel member of the small GTP-binding proteins.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12450215 2002 Identification and characterization of nine novel human small GTPases showing variable expressions in liver cancer tissues.
12414990 2002 A developmentally regulated ARF-like 5 protein (ARL5), localized to nuclei and nucleoli, interacts with heterochromatin protein 1.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.