Property Summary

NCBI Gene PubMed Count 8
PubMed Score 18.76
PubTator Score 4.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Atopic dermatitis -1.200 3.0e-03
atypical teratoid / rhabdoid tumor -1.300 3.3e-03
Breast cancer 2.600 4.6e-02
intraductal papillary-mucinous adenoma (... 1.300 4.5e-02
intraductal papillary-mucinous carcinoma... 1.400 4.3e-02
medulloblastoma, large-cell -1.500 1.4e-06
Multiple myeloma 1.039 1.7e-02
oligodendroglioma -1.100 4.7e-02
osteosarcoma 3.261 2.8e-10
ovarian cancer -1.300 7.9e-05
pancreatic ductal adenocarcinoma liver m... -1.373 3.5e-02
Pick disease 1.500 1.5e-06
psoriasis 2.500 1.3e-05
tuberculosis and treatment for 6 months 1.400 9.4e-05

Synonym

Accession Q9Y689 Q580I5
Symbols ARL5
ARFLP5

Gene

PDB

1Z6Y   1ZJ6   2H16   2H17  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (4)

AA Sequence

MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVINNTRFLMWDIGGQ      1 - 70
ESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQ     71 - 140
FLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR                                   141 - 179
//

Text Mined References (10)

PMID Year Title