Property Summary

NCBI Gene PubMed Count 20
PubMed Score 12.59
PubTator Score 12.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 5.6e-09
osteosarcoma 7950 1.7e-07
psoriasis 6694 1.7e-04
lung cancer 4740 2.9e-04
glioblastoma 5792 3.4e-04
Multiple myeloma 1332 8.9e-04
astrocytoma 1146 1.5e-03
Disease Target Count Z-score Confidence
limb-girdle muscular dystrophy 37 3.546 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytoma 1.100 1.5e-03
glioblastoma 1.400 3.4e-04
lung cancer 1.200 2.9e-04
Multiple myeloma 1.354 8.9e-04
osteosarcoma -2.145 1.7e-07
ovarian cancer 2.900 5.6e-09
psoriasis -1.600 1.7e-04

Gene RIF (8)

AA Sequence

MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLRRFVVRTMC      1 - 70
AVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTVSESEAESATGRFPGAQLKAPLSPLAF     71 - 140
RMEDTEALPLTPILYPTCQFFFFIFLNIFLLAFSSPGSQPLLNSPPSFVCWSRGFMEMNGRGELVESLKR    141 - 210
FCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSL    211 - 280
FVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSS    281 - 350
FPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT    351 - 420
ASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD                  421 - 476
//

Text Mined References (29)

PMID Year Title