Property Summary

NCBI Gene PubMed Count 19
PubMed Score 11.51
PubTator Score 12.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.354 0.001
psoriasis -1.600 0.000
osteosarcoma -2.145 0.000
astrocytoma 1.100 0.002
glioblastoma 1.400 0.000
lung cancer 1.200 0.000
ovarian cancer 2.900 0.000

Synonym

Accession Q9Y679 C0H5W8 Q9H866 Q9UNQ6 Q9Y685
Symbols

Gene

PANTHER Protein Class (2)

PDB

2EKF  

Gene RIF (7)

PMID Text
24039768 Monoubiquitinated AUP1 on the lipid droplet surface specifically induces clustering.
23223569 A novel role for Aup1 in maintenance of intracellular cholesterol homeostasis via mediation of the endoplasmic reticulum associated degradation of HMG-CoA reductase.
23197321 AUP1 targeting signals
21857022 Dual role of ancient ubiquitous protein 1 (AUP1) in lipid droplet accumulation and endoplasmic reticulum (ER) protein quality control.
21127063 The presence of the AUP1-Ube2g2 complex at LDs provides a direct molecular link between LDs and the cellular ubiquitination machinery.
12534237 molecular cloning and sequencing of cDNA and preliminary characterization of protein
12042322 binding of Aup1 plays a crucial role in the alpha(IIb)beta(3) inside-out signaling

AA Sequence

MELPSGPGPERLFDSHRLPGDCFLLLVLLLYAPVGFCLLVLRLFLGIHVFLVSCALPDSVLRRFVVRTMC      1 - 70
AVLGLVARQEDSGLRDHSVRVLISNHVTPFDHNIVNLLTTCSTVSESEAESATGRFPGAQLKAPLSPLAF     71 - 140
RMEDTEALPLTPILYPTCQFFFFIFLNIFLLAFSSPGSQPLLNSPPSFVCWSRGFMEMNGRGELVESLKR    141 - 210
FCASTRLPPTPLLLFPEEEATNGREGLLRFSSWPFSIQDVVQPLTLQVQRPLVSVTVSDASWVSELLWSL    211 - 280
FVPFTVYQVRWLRPVHRQLGEANEEFALRVQQLVAKELGQTGTRLTPADKAEHMKRQRHPRLRPQSAQSS    281 - 350
FPPSPGPSPDVQLATLAQRVKEVLPHVPLGVIQRDLAKTGCVDLTITNLLEGAVAFMPEDITKGTQSLPT    351 - 420
ASASKFPSSGPVTPQPTALTFAKSSWARQESLQERKQALYEYARRRFTERRAQEAD                  421 - 476
//

Publication (28)

PMID Year Title
25660456 2015 Identification of ERAD components essential for dislocation of the null Hong Kong variant of ?-1-antitrypsin (NHK).
24039768 2013 Monoubiquitination of ancient ubiquitous protein 1 promotes lipid droplet clustering.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
23223569 2013 Ancient ubiquitous protein-1 mediates sterol-induced ubiquitination of 3-hydroxy-3-methylglutaryl CoA reductase in lipid droplet-associated endoplasmic reticulum membranes.
23197321 2013 Monotopic topology is required for lipid droplet targeting of ancient ubiquitous protein 1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21857022 2011 Dual role of ancient ubiquitous protein 1 (AUP1) in lipid droplet accumulation and endoplasmic reticulum (ER) protein quality control.
21269460 2011 Initial characterization of the human central proteome.
More...