Property Summary

NCBI Gene PubMed Count 27
Grant Count 6
R01 Count 6
Funding $1,410,770
PubMed Score 46.35
PubTator Score 20.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
pancreatic cancer 1.100 0.001
astrocytic glioma -1.100 0.025
ependymoma -1.200 0.043
psoriasis -1.500 0.000
Atopic dermatitis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.000
pancreatic carcinoma 1.100 0.001
lung adenocarcinoma 1.552 0.000
Gaucher disease type 3 1.700 0.002

Gene RIF (4)

PMID Text
23427261 ERManI and gamma-COP contribute to a golgi-based quality control module that facilitates the retrieval of captured ERAD substrates back to the endoplasmic reticulum.
20468064 Observational study of gene-disease association. (HuGE Navigator)
14690497 Results describe the structure of the appendage domain of gamma-COP and show that it has a similar overall fold as the alpha-appendage of AP2.
11893085 The D1 receptor associates with the gamma-subunit of the COPI coatomer complex. Association between the coatomer complex and hydrophobic residues within the proximal C-terminus of the D1 receptor may serve an important role in receptor transport.

AA Sequence

MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGTTEATEAF      1 - 70
FAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNYRGPAVRALCQITDSTMLQAI     71 - 140
ERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNEAQEAASSDNIMVQYHALGLLYHVRKNDRLA    141 - 210
VNKMISKVTRHGLKSPFAYCMMIRVASKQLEEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGC    211 - 280
SAKELAPAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLK    281 - 350
TGSESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC    351 - 420
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRVVLEHEEVRAG    421 - 490
AVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLER    491 - 560
ALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVKQPEKVAATRQEIFQEQLAAVPEFRGLGPLF    561 - 630
KSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPY    631 - 700
NQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKL    701 - 770
NFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI    771 - 840
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG                                        841 - 874
//

Publication (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23427261 2013 Golgi-situated endoplasmic reticulum ?-1, 2-mannosidase contributes to the retrieval of ERAD substrates through a direct interaction with ?-COP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20674546 2010 COPI-mediated retrograde trafficking from the Golgi to the ER regulates EGFR nuclear transport.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19039328 2009 A COPI coat subunit interacts directly with an early-Golgi localized Arf exchange factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...