Property Summary

NCBI Gene PubMed Count 28
PubMed Score 48.96
PubTator Score 20.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Disease Target Count
malignant mesothelioma 3232
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 2.5e-02
Atopic dermatitis 1.200 2.3e-04
ependymoma -1.200 4.3e-02
Gaucher disease type 1 1.500 3.6e-03
intraductal papillary-mucinous adenoma (... 1.100 8.5e-05
lung adenocarcinoma 1.552 2.9e-10
pancreatic cancer 1.100 6.9e-04
pancreatic carcinoma 1.100 6.9e-04
psoriasis -1.500 1.1e-04

Protein-protein Interaction (11)

Gene RIF (5)

AA Sequence

MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGTTEATEAF      1 - 70
FAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNYRGPAVRALCQITDSTMLQAI     71 - 140
ERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNEAQEAASSDNIMVQYHALGLLYHVRKNDRLA    141 - 210
VNKMISKVTRHGLKSPFAYCMMIRVASKQLEEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGC    211 - 280
SAKELAPAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLK    281 - 350
TGSESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC    351 - 420
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRVVLEHEEVRAG    421 - 490
AVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLER    491 - 560
ALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVKQPEKVAATRQEIFQEQLAAVPEFRGLGPLF    561 - 630
KSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPY    631 - 700
NQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKL    701 - 770
NFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI    771 - 840
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG                                        841 - 874
//

Text Mined References (33)

PMID Year Title