Property Summary

NCBI Gene PubMed Count 27
PubMed Score 46.35
PubTator Score 20.76

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.86295852029531E-10
intraductal papillary-mucinous adenoma (IPMA) 2956 8.54887598748732E-5
psoriasis 6685 1.1331451490388E-4
Atopic dermatitis 944 2.3207038579658E-4
pancreatic cancer 2300 6.92567427904343E-4
pancreatic carcinoma 567 6.92567427904345E-4
Gaucher disease type 3 76 0.00159402879932682
astrocytic glioma 2241 0.0254893398843127
ependymoma 2514 0.0426828706579396

Expression

  Differential Expression (9)

Disease log2 FC p
pancreatic cancer 1.100 0.001
astrocytic glioma -1.100 0.025
ependymoma -1.200 0.043
psoriasis -1.500 0.000
Atopic dermatitis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.100 0.000
pancreatic carcinoma 1.100 0.001
lung adenocarcinoma 1.552 0.000
Gaucher disease type 3 1.700 0.002

Synonym

Accession Q9Y678 A8K6M8 B3KMF6 Q54AC4
Symbols COPG

Gene

PDB

1R4X  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (4)

PMID Text
23427261 ERManI and gamma-COP contribute to a golgi-based quality control module that facilitates the retrieval of captured ERAD substrates back to the endoplasmic reticulum.
20468064 Observational study of gene-disease association. (HuGE Navigator)
14690497 Results describe the structure of the appendage domain of gamma-COP and show that it has a similar overall fold as the alpha-appendage of AP2.
11893085 The D1 receptor associates with the gamma-subunit of the COPI coatomer complex. Association between the coatomer complex and hydrophobic residues within the proximal C-terminus of the D1 receptor may serve an important role in receptor transport.

AA Sequence

MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTKILYLINQGEHLGTTEATEAF      1 - 70
FAMTKLFQSNDPTLRRMCYLTIKEMSCIAEDVIIVTSSLTKDMTGKEDNYRGPAVRALCQITDSTMLQAI     71 - 140
ERYMKQAIVDKVPSVSSSALVSSLHLLKCSFDVVKRWVNEAQEAASSDNIMVQYHALGLLYHVRKNDRLA    141 - 210
VNKMISKVTRHGLKSPFAYCMMIRVASKQLEEEDGSRDSPLFDFIESCLRNKHEMVVYEAASAIVNLPGC    211 - 280
SAKELAPAVSVLQLFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLK    281 - 350
TGSESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEYKRAIVDC    351 - 420
IISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYIRFIYNRVVLEHEEVRAG    421 - 490
AVSALAKFGAQNEEMLPSILVLLKRCVMDDDNEVRDRATFYLNVLEQKQKALNAGYILNGLTVSIPGLER    491 - 560
ALQQYTLEPSEKPFDLKSVPLATAPMAEQRTESTPITAVKQPEKVAATRQEIFQEQLAAVPEFRGLGPLF    561 - 630
KSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEPTEAYEVLCYVPARSLPY    631 - 700
NQPGTCYTLVALPKEDPTAVACTFSCMMKFTVKDCDPTTGETDDEGYEDEYVLEDLEVTVADHIQKVMKL    701 - 770
NFEAAWDEVGDEFEKEETFTLSTIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDI    771 - 840
LVRSRLLLLDTVTMQVTARSLEELPVDIILASVG                                        841 - 874
//

Text Mined References (32)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23427261 2013 Golgi-situated endoplasmic reticulum ?-1, 2-mannosidase contributes to the retrieval of ERAD substrates through a direct interaction with ?-COP.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20674546 2010 COPI-mediated retrograde trafficking from the Golgi to the ER regulates EGFR nuclear transport.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
19039328 2009 A COPI coat subunit interacts directly with an early-Golgi localized Arf exchange factor.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...