Property Summary

NCBI Gene PubMed Count 14
PubMed Score 3.29
PubTator Score 1.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
psoriasis -1.200 0.001
intraductal papillary-mucinous neoplasm ... -1.200 0.002
lung cancer 1.300 0.001
ovarian cancer 1.200 0.011

Synonym

Accession Q9Y676 A6NDQ0 Q659G4 Q9BS27 MRP-S18-b
Symbols PTD017
S18amt
C6orf14
HSPC183
MRPS18-2
HumanS18a
MRP-S18-2

Gene

PDB

3J9M  

Gene RIF (4)

PMID Text
26023799 S18-2 is a newly identified oncoprotein that may be involved in cancerogenesis
20877624 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
18391203 EBNA-6 {ebna-3c} binds to MRPS18-2 , and targets it to the nucleus; binding targets the small pocket of pRb, which is a site of interaction with E2F1. The MRPS18-2 competes with the binding of E2F1 to pRb, thereby raising the level of free E2F1

AA Sequence

MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGS      1 - 70
RPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYT     71 - 140
GVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPE    141 - 210
RELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL                          211 - 258
//

Publication (20)

PMID Year Title
26023799 2015 Mitochondrial ribosomal protein S18-2 evokes chromosomal instability and transforms primary rat skin fibroblasts.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18391203 2008 EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
More...