Tdark | 28S ribosomal protein S18b, mitochondrial |
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S18P family. The encoded protein is one of three that has significant sequence similarity to bacterial S18 proteins. The primary sequences of the three human mitochondrial S18 proteins are no more closely related to each other than they are to the prokaryotic S18 proteins. Pseudogenes corresponding to this gene are found on chromosomes 1q and 2q. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count |
---|---|
Disease Progression | 125 |
Stomach Neoplasms | 282 |
Disease | Target Count | P-value |
---|---|---|
malignant mesothelioma | 3163 | 1.86117850617395E-6 |
lung cancer | 4473 | 0.00100166424727067 |
psoriasis | 6685 | 0.00108419308966965 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00171922841692528 |
ovarian cancer | 8492 | 0.0106538635646358 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | 1.100 | 0.000 |
psoriasis | -1.200 | 0.001 |
intraductal papillary-mucinous neoplasm ... | -1.200 | 0.002 |
lung cancer | 1.300 | 0.001 |
ovarian cancer | 1.200 | 0.011 |
Species | Source |
---|---|
Chimp | OMA Inparanoid |
Macaque | OMA Inparanoid |
Mouse | OMA Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA Inparanoid |
Cow | OMA Inparanoid |
Pig | OMA Inparanoid |
Opossum | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
PMID | Text |
---|---|
26023799 | S18-2 is a newly identified oncoprotein that may be involved in cancerogenesis |
20877624 | Observational study of gene-disease association. (HuGE Navigator) |
19851445 | Observational study of gene-disease association. (HuGE Navigator) |
18391203 | EBNA-6 {ebna-3c} binds to MRPS18-2 , and targets it to the nucleus; binding targets the small pocket of pRb, which is a site of interaction with E2F1. The MRPS18-2 competes with the binding of E2F1 to pRb, thereby raising the level of free E2F1 |
MAASVLNTVLRRLPMLSLFRGSHRVQVPLQTLCTKAPSEEDSLSSVPISPYKDEPWKYLESEEYQERYGS 1 - 70 RPVWADYRRNHKGGVPPQRTRKTCIRRNKVVGNPCPICRDHKLHVDFRNVKLLEQFVCAHTGIIFYAPYT 71 - 140 GVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDLDFSTSHGAVSATPPAPTLVSGDPWYPWYNWKQPPE 141 - 210 RELSRLRRLYQGHLQEESGPPPESMPKMPPRTPAEASSTGQTGPQSAL 211 - 258 //
PMID | Year | Title |
---|---|---|
26023799 | 2015 | Mitochondrial ribosomal protein S18-2 evokes chromosomal instability and transforms primary rat skin fibroblasts. |
25944712 | 2015 | N-terminome analysis of the human mitochondrial proteome. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
21269460 | 2011 | Initial characterization of the human central proteome. |
20877624 | 2010 | Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression. |
19851445 | 2009 | High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions. |
18691976 | 2008 | Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. |
18391203 | 2008 | EBV-encoded EBNA-6 binds and targets MRS18-2 to the nucleus, resulting in the disruption of pRb-E2F1 complexes. |
17974005 | 2007 | The full-ORF clone resource of the German cDNA Consortium. |
17353931 | 2007 | Large-scale mapping of human protein-protein interactions by mass spectrometry. |
More... |