Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.44
PubTator Score 7.53

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Type 2 diabetes mellitus 272 0.0 1.1
Disease Target Count Z-score Confidence
Prader-Willi syndrome 48 5.6 2.8
Angelman syndrome 34 4.837 2.4

Expression

Synonym

Accession Q9Y675 A6NCW2
Symbols

Gene

  Ortholog (2)

Gene RIF (5)

AA Sequence

MERARDRLHLRRTTEQHVPEVEVQVKRRRTASLSNQECQLYPRRSQQQQVPVVDFQAELRQAFLAETPRG      1 - 70
G//

Text Mined References (24)

PMID Year Title