Property Summary

NCBI Gene PubMed Count 7
PubMed Score 10.20
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 1.38115421091508E-7
pilocytic astrocytoma 3086 1.51119687990146E-5
pancreatic cancer 2300 9.14939309732492E-4
group 3 medulloblastoma 2254 0.0011248681510619
dermatomyositis 967 0.00324838946494533
primary pancreatic ductal adenocarcinoma 1271 0.00502869734454483
glioblastoma 5572 0.00860677791738421
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 4.332 2.2

Expression

  Differential Expression (7)

Disease log2 FC p
glioblastoma 1.200 0.009
primary pancreatic ductal adenocarcinoma -1.824 0.005
group 3 medulloblastoma 1.200 0.001
pilocytic astrocytoma 1.100 0.000
ovarian cancer -1.900 0.000
pancreatic cancer -1.600 0.001
dermatomyositis 1.600 0.003

Synonym

Accession Q9Y673 B4DR37 Q5TBA6 DolP-glucosyltransferase
Symbols bA421P11.2

Gene

PANTHER Protein Class (2)

  Ortholog (17)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid
C. elegans OMA EggNOG
Fruitfly OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

AA Sequence

MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVV      1 - 70
VPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKN     71 - 140
RGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSY    141 - 210
FRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAV    211 - 280
NWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN                              281 - 324
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...