Property Summary

NCBI Gene PubMed Count 7
PubMed Score 11.09
PubTator Score 5.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
dermatomyositis 1.600 3.2e-03
glioblastoma 1.200 8.6e-03
group 3 medulloblastoma 1.200 1.1e-03
ovarian cancer -1.900 1.4e-07
pancreatic cancer -1.600 9.1e-04
pancreatic ductal adenocarcinoma liver m... -1.813 9.8e-03
Pilocytic astrocytoma 1.100 1.5e-05

Protein-protein Interaction (2)

AA Sequence

MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVV      1 - 70
VPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKN     71 - 140
RGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSY    141 - 210
FRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAV    211 - 280
NWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN                              281 - 324
//

Text Mined References (13)

PMID Year Title