Property Summary

NCBI Gene PubMed Count 23
Grant Count 24
R01 Count 18
Funding $1,711,430.14
PubMed Score 25.48
PubTator Score 19.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma 1.500 0.000
intraductal papillary-mucinous neoplasm ... 1.500 0.001
spina bifida 1.167 0.047
ovarian cancer 1.100 0.000

Gene RIF (12)

PMID Text
26454676 SLC12A7 gene amplification and overexpression occurs frequently in adrenocortical carcinoma and may play a role in adrenocortical carcinoma tumorigenesis.
21760919 Negative stain transmission electron microscopy and single particle analysis of KCC4 and the aquaporin-1 AQP1 water channel, revealed the expected quaternary structures within homogeneous preparations, and thus correct protein folding and assembly.
21733850 KCC3 is the dominant isoform in erythrocytes, with variable expression of KCC1 and KCC4 that could result in modulation of KCC activity
21613606 The Wnk3 protein isoforms have a similar effect on SLC12 cotransporters. NKCC1/2 and NCC were inhibited, even in hypertonicity, while KCCs were activated, even in isotonic conditions.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20516068 analysis of differences in large extracellular loop between the K(+)-Cl(-) cotransporters KCC2 and KCC4
19887603 In the metastatic cancer tissues, KCC4 colocalizes with IGF-I or EGF.
18984587 KCC4 and H+,K+-ATPase are the main machineries for basal HCl secretion in the apical canalicular membrane of the resting parietal cell. They also may contribute in part to massive acid secretion in the stimulated state.
17133354 Among patients with early-stage node-negative breast cancer, disease-free survival (DFS) and overall survival (OS) curves were significantly different based on IGF-1 and KCC expression.
15262997 KCC activation by IGF-1 plays an important role in IGF-1 signaling to promote growth and spread of gynecological cancers.
More...

AA Sequence

MPTNFTVVPVEAHADGGGDETAERTEAPGTPEGPEPERPSPGDGNPRENSPFLNNVEVEQESFFEGKNMA      1 - 70
LFEEEMDSNPMVSSLLNKLANYTNLSQGVVEHEEDEESRRREAKAPRMGTFIGVYLPCLQNILGVILFLR     71 - 140
LTWIVGVAGVLESFLIVAMCCTCTMLTAISMSAIATNGVVPAGGSYYMISRSLGPEFGGAVGLCFYLGTT    141 - 210
FAGAMYILGTIEIFLTYISPGAAIFQAEAAGGEAAAMLHNMRVYGTCTLVLMALVVFVGVKYVNKLALVF    211 - 280
LACVVLSILAIYAGVIKSAFDPPDIPVCLLGNRTLSRRSFDACVKAYGIHNNSATSALWGLFCNGSQPSA    281 - 350
ACDEYFIQNNVTEIQGIPGAASGVFLENLWSTYAHAGAFVEKKGVPSVPVAEESRASALPYVLTDIAASF    351 - 420
TLLVGIYFPSVTGIMAGSNRSGDLKDAQKSIPTGTILAIVTTSFIYLSCIVLFGACIEGVVLRDKFGEAL    421 - 490
QGNLVIGMLAWPSPWVIVIGSFFSTCGAGLQSLTGAPRLLQAIARDGIVPFLQVFGHGKANGEPTWALLL    491 - 560
TVLICETGILIASLDSVAPILSMFFLMCYLFVNLACAVQTLLRTPNWRPRFKFYHWTLSFLGMSLCLALM    561 - 630
FICSWYYALSAMLIAGCIYKYIEYRGAEKEWGDGIRGLSLNAARYALLRVEHGPPHTKNWRPQVLVMLNL    631 - 700
DAEQAVKHPRLLSFTSQLKAGKGLTIVGSVLEGTYLDKHMEAQRAEENIRSLMSTEKTKGFCQLVVSSSL    701 - 770
RDGMSHLIQSAGLGGLKHNTVLMAWPASWKQEDNPFSWKNFVDTVRDTTAAHQALLVAKNVDSFPQNQER    771 - 840
FGGGHIDVWWIVHDGGMLMLLPFLLRQHKVWRKCRMRIFTVAQVDDNSIQMKKDLQMFLYHLRISAEVEV    841 - 910
VEMVENDISAFTYERTLMMEQRSQMLKQMQLSKNEQEREAQLIHDRNTASHTAAAARTQAPPTPDKVQMT    911 - 980
WTREKLIAEKYRSRDTSLSGFKDLFSMKPDQSNVRRMHTAVKLNGVVLNKSQDAQLVLLNMPGPPKNRQG    981 - 1050
DENYMEFLEVLTEGLNRVLLVRGGGREVITIYS                                        1051 - 1083
//

Text Mined References (28)

PMID Year Title
26454676 2016 DNA copy amplification and overexpression of SLC12A7 in adrenocortical carcinoma.
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
24393035 2014 The WNK-regulated SPAK/OSR1 kinases directly phosphorylate and inhibit the K+-Cl- co-transporters.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
21760919 2011 Frog oocytes to unveil the structure and supramolecular organization of human transport proteins.
21733850 2011 K-Cl cotransporter gene expression during human and murine erythroid differentiation.
21613606 2011 Similar effects of all WNK3 variants on SLC12 cotransporters.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20516068 2010 Differences in the large extracellular loop between the K(+)-Cl(-) cotransporters KCC2 and KCC4.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
More...