Property Summary

NCBI Gene PubMed Count 17
PubMed Score 6.35
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma -1.278 4.1e-03
aldosterone-producing adenoma -1.804 1.2e-02
Atopic dermatitis 1.700 4.8e-04
cutaneous lupus erythematosus 1.600 4.7e-03
cystic fibrosis 4.457 1.5e-07
ependymoma 1.600 4.3e-03
glioblastoma 2.100 2.4e-02
malignant mesothelioma -1.700 6.4e-07
non-small cell lung cancer 1.194 6.2e-11
osteosarcoma 2.664 9.4e-03
pancreatic cancer 1.200 1.0e-04
pediatric high grade glioma 1.900 1.2e-02
psoriasis 2.600 4.0e-79
subependymal giant cell astrocytoma 4.004 1.9e-03

Gene RIF (5)

AA Sequence

MAPPGPASALSTSAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCQTLSGPVVGLSGGGEEAGAPGGGV      1 - 70
LAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT     71 - 140
LALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQ    141 - 210
ITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLID    211 - 280
TSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFP    281 - 350
CLKKAEGSSRPHCLGKTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWDG                  351 - 406
//

Text Mined References (18)

PMID Year Title