Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.47
PubTator Score 7.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 4.01866572562326E-79
non-small cell lung cancer 2798 6.20163240995622E-11
cystic fibrosis 1670 1.48619791140873E-7
malignant mesothelioma 3163 6.38952510395176E-7
posterior fossa group A ependymoma 1511 1.63899486603059E-6
pancreatic cancer 2300 1.03099267393731E-4
Atopic dermatitis 944 4.80221540413893E-4
subependymal giant cell astrocytoma 2287 0.00191440964109195
adrenocortical carcinoma 1427 0.00410426141198806
cutaneous lupus erythematosus 1056 0.00466012933213485
osteosarcoma 7933 0.00937933443426889
pediatric high grade glioma 2712 0.0118962608764204
aldosterone-producing adenoma 664 0.012476078674823
glioblastoma 5572 0.0241818046861536
Disease Target Count Z-score Confidence
Vascular disease 281 0.0 1.0

Expression

  Differential Expression (14)

Synonym

Accession Q9Y663 A8K7N2
Symbols 3OST3A1
3-OST-3A

Gene

PDB

1T8T   1T8U  

  Ortholog (5)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA Inparanoid

Gene RIF (3)

PMID Text
26410339 decreased in pre-eclamptic placental tissue
22475533 Genetic variants of HS3ST3A1 and HS3ST3B1 are associated with Plasmodium falciparum parasitaemia.
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPPGPASALSTSAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCQTLSGPVVGLSGGGEEAGAPGGGV      1 - 70
LAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT     71 - 140
LALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQ    141 - 210
ITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLID    211 - 280
TSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFP    281 - 350
CLKKAEGSSRPHCLGKTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWDG                  351 - 406
//

Text Mined References (16)

PMID Year Title
26410339 2015 Placental expression of heparan sulfate 3-O-sulfotransferase-3A1 in normotensive and pre-eclamptic pregnancies.
22922681 2012 Establishment of a human lung cancer cell line with high metastatic potential to multiple organs: gene expression associated with metastatic potential in human lung cancer.
22475533 2012 Genetic variations in genes involved in heparan sulphate biosynthesis are associated with Plasmodium falciparum parasitaemia: a familial study in Burkina Faso.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304505 2004 Structural analysis of the sulfotransferase (3-o-sulfotransferase isoform 3) involved in the biosynthesis of an entry receptor for herpes simplex virus 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...