Property Summary

NCBI Gene PubMed Count 15
Grant Count 1
Funding $91,040.56
PubMed Score 6.47
PubTator Score 7.37

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession Q9Y663 A8K7N2
Symbols 3OST3A1
3-OST-3A

Gene

 Grant Application (1)

PDB

1T8T   1T8U  

Gene RIF (3)

PMID Text
26410339 decreased in pre-eclamptic placental tissue
22475533 Genetic variants of HS3ST3A1 and HS3ST3B1 are associated with Plasmodium falciparum parasitaemia.
20487506 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MAPPGPASALSTSAEPLSRSIFRKFLLMLCSLLTSLYVFYCLAERCQTLSGPVVGLSGGGEEAGAPGGGV      1 - 70
LAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT     71 - 140
LALLLDEGSKQLPQAIIIGVKKGGTRALLEFLRVHPDVRAVGAEPHFFDRSYDKGLAWYRDLMPRTLDGQ    141 - 210
ITMEKTPSYFVTREAPARISAMSKDTKLIVVVRDPVTRAISDYTQTLSKRPDIPTFESLTFKNRTAGLID    211 - 280
TSWSAIQIGIYAKHLEHWLRHFPIRQMLFVSGERLISDPAGELGRVQDFLGLKRIITDKHFYFNKTKGFP    281 - 350
CLKKAEGSSRPHCLGKTKGRTHPEIDREVVRRLREFYRPFNLKFYQMTGHDFGWDG                  351 - 406
//

Publication (16)

PMID Year Title
26410339 2015 Placental expression of heparan sulfate 3-O-sulfotransferase-3A1 in normotensive and pre-eclamptic pregnancies.
22922681 2012 Establishment of a human lung cancer cell line with high metastatic potential to multiple organs: gene expression associated with metastatic potential in human lung cancer.
22475533 2012 Genetic variations in genes involved in heparan sulphate biosynthesis are associated with Plasmodium falciparum parasitaemia: a familial study in Burkina Faso.
20487506 2010 A whole genome association study of mother-to-child transmission of HIV in Malawi.
17903302 2007 Framingham Heart Study 100K Project: genome-wide associations for blood pressure and arterial stiffness.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15304505 2004 Structural analysis of the sulfotransferase (3-o-sulfotransferase isoform 3) involved in the biosynthesis of an entry receptor for herpes simplex virus 1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...