Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $228,312.5
PubMed Score 3.14
PubTator Score 2.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.700 0.003
posterior fossa group A ependymoma -2.700 0.000
oligodendroglioma -1.800 0.004
glioblastoma -2.200 0.000
sonic hedgehog group medulloblastoma -2.100 0.000
atypical teratoid/rhabdoid tumor -2.300 0.000
primitive neuroectodermal tumor -2.300 0.000
breast carcinoma -1.100 0.002
pediatric high grade glioma -2.300 0.000
pilocytic astrocytoma -1.900 0.000
Breast cancer -2.300 0.000

Synonym

Accession Q9Y661 Q5QI42 Q8NDC2
Symbols 30ST4
3OST4
3-OST-4
h3-OST-4

Gene

Gene RIF (4)

PMID Text
25648963 This study provided that additional genome-wide associations, near HS3ST4 were identified and other putative modulators of memory performance were revealed by a pathway approach and hippocampal gene expression analyses.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18757372 The 3OST-2 and -4 are specifically expressed in brain.
17482450 3-OST-2 and 3-OST-4 are the major neural gD-type 3-OSTs, and so are prime candidates for participating in HS-dependent neurobiologic events.

AA Sequence

MARWPAPPPPPPPPPPLAAPPPPGASAKGPPARKLLFMCTLSLSVTYLCYSLLGGSGSLQFPLALQESPG      1 - 70
AAAEPPPSPPPPSLLPTPVRLGAPSQPPAPPPLDNASHGEPPEPPEQPAAPGTDGWGLPSGGGGAQDAWL     71 - 140
RTPLAPSEMITAQSALPEREAQESSTTDEDLAGRRAANGSSERGGAVSTPDYGEKKLPQALIIGVKKGGT    141 - 210
RALLEAIRVHPDVRAVGVEPHFFDRNYEKGLEWYRNVMPKTLDGQITMEKTPSYFVTNEAPKRIHSMAKD    211 - 280
IKLIVVVRNPVTRAISDYTQTLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLS    281 - 350
QILFVSGERLIVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRI    351 - 420
DPDVIHRLRKFYKPFNLMFYQMTGQDFQWEQEEGDK                                      421 - 456
//

Text Mined References (11)

PMID Year Title
25648963 2015 Genome-wide studies of verbal declarative memory in nondemented older people: the Cohorts for Heart and Aging Research in Genomic Epidemiology consortium.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18757372 2008 Tetrasulfated disaccharide unit in heparan sulfate: enzymatic formation and tissue distribution.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17482450 2007 The principal neuronal gD-type 3-O-sulfotransferases and their products in central and peripheral nervous system tissues.
16259945 2005 A role for 3-O-sulfotransferase isoform-4 in assisting HSV-1 entry and spread.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12080045 2002 Characterization of a heparan sulfate octasaccharide that binds to herpes simplex virus type 1 glycoprotein D.
More...