Property Summary

NCBI Gene PubMed Count 9
PubMed Score 2.98
PubTator Score 2.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.500 5.7e-03
astrocytic glioma -1.700 2.7e-03
Astrocytoma, Pilocytic -1.900 2.7e-06
atypical teratoid / rhabdoid tumor -2.100 6.6e-07
Breast cancer -2.100 1.7e-35
breast carcinoma -1.100 1.8e-03
ependymoma -2.400 1.8e-03
glioblastoma -2.200 4.0e-08
group 4 medulloblastoma -1.900 5.4e-04
oligodendroglioma -1.800 4.1e-03
primitive neuroectodermal tumor -2.300 1.9e-04

Gene RIF (4)

AA Sequence

MARWPAPPPPPPPPPPLAAPPPPGASAKGPPARKLLFMCTLSLSVTYLCYSLLGGSGSLQFPLALQESPG      1 - 70
AAAEPPPSPPPPSLLPTPVRLGAPSQPPAPPPLDNASHGEPPEPPEQPAAPGTDGWGLPSGGGGAQDAWL     71 - 140
RTPLAPSEMITAQSALPEREAQESSTTDEDLAGRRAANGSSERGGAVSTPDYGEKKLPQALIIGVKKGGT    141 - 210
RALLEAIRVHPDVRAVGVEPHFFDRNYEKGLEWYRNVMPKTLDGQITMEKTPSYFVTNEAPKRIHSMAKD    211 - 280
IKLIVVVRNPVTRAISDYTQTLSKKPEIPTFEVLAFKNRTLGLIDASWSAIRIGIYALHLENWLQYFPLS    281 - 350
QILFVSGERLIVDPAGEMAKVQDFLGLKRVVTEKHFYFNKTKGFPCLKKPEDSSAPRCLGKSKGRTHPRI    351 - 420
DPDVIHRLRKFYKPFNLMFYQMTGQDFQWEQEEGDK                                      421 - 456
//

Text Mined References (11)

PMID Year Title