Property Summary

NCBI Gene PubMed Count 25
Grant Count 16
R01 Count 4
Funding $1,761,275.08
PubMed Score 99.01
PubTator Score 3749.06

Knowledge Summary

Patent

No data available

Expression

Gene RIF (11)

PMID Text
25749382 High SPIN1 expression is associated with liposarcoma.
24589551 Spindlin1 activates Wnt/beta-catenin signaling downstream from protein arginine methyltransferase 2 (PRMT2) and the MLL complex, which together are capable of generating a specific H3 "K4me3-R8me2a" pattern.
23077255 the histone sequence is recognized in a distinct manner involving the amino terminus and a pair of arginine residues of histone H3, and disruption of the binding impaired stimulation of pre-RNA expression by Spindlin1
22258766 SPINDLIN1, which may be a novel substrate of the Aurora-A kinase, promotes cancer cell growth through WNT/TCF-4 signaling activation.
21960006 Spindlin1 localizes to the active ribosomal DNA (rDNA) repeats, and Spindlin1 facilitates the expression of ribosomal RNA genes.
21044367 Observational study of gene-disease association. (HuGE Navigator)
18543248 Excess spindlin1 protein may be detrimental for spindle microtubule organization, chromosomal stability and can potentially contribute to the development of cancer.
18201843 SPINDLIN1 is an important gene for mammalian mitotic chromosome functions, and disrupted regulation results in abnormal cell division, a mechanism that may be involved in tumorigenesis
17082182 analysis of human spindlin1 tudor-like domains for cell cycle regulation
16472086 recombinant human spindlin1 has been overexpressed in Escherichia coli BL21, purified and crystallized using the hanging-drop vapour-diffusion method
More...

AA Sequence

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVT      1 - 70
QWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHM     71 - 140
FETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVV    141 - 210
DSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS                      211 - 262
//

Text Mined References (29)

PMID Year Title
25749382 2015 The histone code reader SPIN1 controls RET signaling in liposarcoma.
25277244 2014 The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
24589551 2014 Molecular basis underlying histone H3 lysine-arginine methylation pattern readout by Spin/Ssty repeats of Spindlin1.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077255 2012 Distinct mode of methylated lysine-4 of histone H3 recognition by tandem tudor-like domains of Spindlin1.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22258766 2012 SPINDLIN1 promotes cancer cell proliferation through activation of WNT/TCF-4 signaling.
21960006 2011 Nucleolar protein Spindlin1 recognizes H3K4 methylation and stimulates the expression of rRNA genes.
21044367 2010 An integrative method for scoring candidate genes from association studies: application to warfarin dosing.
21029866 2010 Nucleosome-interacting proteins regulated by DNA and histone methylation.
More...