Property Summary

NCBI Gene PubMed Count 48
Grant Count 38
R01 Count 16
Funding $7,170,116.83
PubMed Score 90.42
PubTator Score 68.90

Knowledge Summary

Patent (6,463)

Expression

Gene RIF (30)

PMID Text
26834243 High GPR56 expression was significantly associated with high-risk genetic subgroups and poor outcome in patients with acute myeloid leukemia and identifies cancer stem cells with high repopulating potential.
26710850 Data suggest that agonist-induced signal transduction via either GPR56/ADGRG1 or BAI1/ADGRB1 does not require conserved membrane-proximal stalk region of these proteins; ADGRG1 may participate in stalk-dependent and stalk-independent signaling.
26116532 we knocked down GPR56 in cardiomyocytes and found that GPR56 promoted Ang II-induced cardiomyocyte hypertrophy and it contributed to PCBP2 effects on cardiomyocyte hypertrophy
25918380 GPR56 and GPR110 are activated by exposure of a cryptic tethered agonist
25832639 Agonistic antibodies reveal the function of GPR56 in human glioma U87-MG cells
25547674 Data show that Gpr56, a G-coupled protein receptor, is required for hematopoietic cluster formation during transdifferentiation process in endothelial to hematopoietic cell transition (EHT).
24742924 These findings demonstrate that reduced expression of GPR56 in lung fibroblasts may be an important link with pulmonary fibrosis, playing a role in regulating some important fibroblast functions.
24531968 these data reveal a mechanism by which control of GPR56 expression pattern by multiple alternative promoters can influence stem cell proliferation, gyral patterning, and, potentially, neocortex evolution.
24102982 Loss of GPR56 is associated with abnormal muscle development.
23902976 GPR56, MT1G, and RASSF1 might be the potential methylation markers associated with acquired multidrug resistance of lung adenocarcinoma.
More...

AA Sequence

MTPQSLLQTTLFLLSLLFLVQGAHGRGHREDFRFCSQRNQTHRSSLHYKPTPDLRISIENSEEALTVHAP      1 - 70
FPAAHPASRSFPDPRGLYHFCLYWNRHAGRLHLLYGKRDFLLSDKASSLLCFQHQEESLAQGPPLLATSV     71 - 140
TSWWSPQNISLPSAASFTFSFHSPPHTAAHNASVDMCELKRDLQLLSQFLKHPQKASRRPSAAPASQQLQ    141 - 210
SLESKLTSVRFMGDMVSFEEDRINATVWKLQPTAGLQDLHIHSRQEEEQSEIMEYSVLLPRTLFQRTKGR    211 - 280
SGEAEKRLLLVDFSSQALFQDKNSSQVLGEKVLGIVVQNTKVANLTEPVVLTFQHQLQPKNVTLQCVFWV    281 - 350
EDPTLSSPGHWSSAGCETVRRETQTSCFCNHLTYFAVLMVSSVEVDAVHKHYLSLLSYVGCVVSALACLV    351 - 420
TIAAYLCSRVPLPCRRKPRDYTIKVHMNLLLAVFLLDTSFLLSEPVALTGSEAGCRASAIFLHFSLLTCL    421 - 490
SWMGLEGYNLYRLVVEVFGTYVPGYLLKLSAMGWGFPIFLVTLVALVDVDNYGPIILAVHRTPEGVIYPS    491 - 560
MCWIRDSLVSYITNLGLFSLVFLFNMAMLATMVVQILRLRPHTQKWSHVLTLLGLSLVLGLPWALIFFSF    561 - 630
ASGTFQLVVLYLFSIITSFQGFLIFIWYWSMRLQARGGPSPLKSNSDSARLPISSGSTSSSRI           631 - 693
//

Text Mined References (54)

PMID Year Title
27068534 2016 Heparin interacts with the adhesion GPCR GPR56, reduces receptor shedding, and promotes cell adhesion and motility.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26834243 2016 GPR56 identifies primary human acute myeloid leukemia cells with high repopulating potential in vivo.
26710850 2016 Stalk-dependent and Stalk-independent Signaling by the Adhesion G Protein-coupled Receptors GPR56 (ADGRG1) and BAI1 (ADGRB1).
26116532 2015 The RNA-binding protein PCBP2 inhibits Ang II-induced hypertrophy of cardiomyocytes though promoting GPR56 mRNA degeneration.
25918380 2015 Adhesion G protein-coupled receptors are activated by exposure of a cryptic tethered agonist.
25832639 2015 Agonistic antibodies reveal the function of GPR56 in human glioma U87-MG cells.
25713288 2015 International Union of Basic and Clinical Pharmacology. XCIV. Adhesion G protein-coupled receptors.
25547674 2015 Whole-transcriptome analysis of endothelial to hematopoietic stem cell transition reveals a requirement for Gpr56 in HSC generation.
24949629 2014 Mechanism for adhesion G protein-coupled receptor GPR56-mediated RhoA activation induced by collagen III stimulation.
More...