Property Summary

NCBI Gene PubMed Count 12
PubMed Score 29.11
PubTator Score 7.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8520 3.3e-06
osteosarcoma 7950 3.9e-05
glioblastoma 5792 1.4e-03
atypical teratoid / rhabdoid tumor 5112 7.4e-03
pediatric high grade glioma 1064 1.1e-02
Disease Target Count Z-score Confidence
Panic disorder 61 0.0 2.2
Disease Target Count Z-score Confidence
Lambert-Eaton myasthenic syndrome 12 3.11 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.300 7.4e-03
glioblastoma 1.600 1.4e-03
osteosarcoma 1.196 3.9e-05
ovarian cancer 1.200 3.3e-06
pediatric high grade glioma 1.100 1.1e-02

Gene RIF (2)

AA Sequence

MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK      1 - 70
EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAA     71 - 140
AAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAA    141 - 210
AAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL        211 - 276
//

Text Mined References (13)

PMID Year Title