Property Summary

NCBI Gene PubMed Count 12
Grant Count 1
Funding $229,997
PubMed Score 30.27
PubTator Score 7.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.196 0.000
atypical teratoid / rhabdoid tumor 1.300 0.007
glioblastoma 1.600 0.001
pediatric high grade glioma 1.100 0.011
ovarian cancer 1.200 0.000

Gene RIF (2)

PMID Text
23463365 Tumors originating from glioma cells with an induced expression of Sox21 exhibited an increased formation of Sox2:Sox21 complexes and an upregulation of S100beta, CNPase and Tuj1
20824710 suggest that Sox21 can negatively regulate Sox2 in glioma. Our findings imply that Sox2 and Sox21 may be interesting targets for the development of novel glioma therapy

AA Sequence

MSKPVDHVKRPMNAFMVWSRAQRRKMAQENPKMHNSEISKRLGAEWKLLTESEKRPFIDEAKRLRAMHMK      1 - 70
EHPDYKYRPRRKPKTLLKKDKFAFPVPYGLGGVADAEHPALKAGAGLHAGAGGGLVPESLLANPEKAAAA     71 - 140
AAAAAARVFFPQSAAAAAAAAAAAAAGSPYSLLDLGSKMAEISSSSSGLPYASSLGYPTAGAGAFHGAAA    141 - 210
AAAAAAAAAGGHTHSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQLDPYPAAYAAAL        211 - 276
//

Publication (13)

PMID Year Title
24485021 2014 A panel of genes methylated with high frequency in colorectal cancer.
23463365 2013 Sox21 inhibits glioma progression in vivo by forming complexes with Sox2 and stimulating aberrant differentiation.
20876214 2011 Rapid activation of the bivalent gene Sox21 requires displacement of multiple layers of gene-silencing machinery.
20824710 2011 Forced expression of Sox21 inhibits Sox2 and induces apoptosis in human glioma cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12194848 2002 Twenty pairs of sox: extent, homology, and nomenclature of the mouse and human sox transcription factor gene families.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10441749 1999 The isolation and high-resolution chromosomal mapping of human SOX14 and SOX21; two members of the SOX gene family related to SOX1, SOX2, and SOX3.
More...