Property Summary

NCBI Gene PubMed Count 16
PubMed Score 330.93
PubTator Score 1268.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.300 1.9e-02
Astrocytoma, Pilocytic 1.200 4.2e-05
Atopic dermatitis -1.300 2.0e-04
colon cancer -1.600 3.7e-03
ependymoma 1.100 3.3e-08
group 3 medulloblastoma -1.500 4.0e-03
intraductal papillary-mucinous adenoma (... -1.400 1.4e-03
intraductal papillary-mucinous carcinoma... -2.000 5.1e-03
intraductal papillary-mucinous neoplasm ... -2.000 2.5e-03
lung adenocarcinoma -1.100 9.2e-06
malignant mesothelioma -4.200 3.0e-07
non-small cell lung cancer -1.049 9.3e-12
oligodendroglioma -1.100 4.2e-02
osteosarcoma 1.161 6.4e-03
ovarian cancer -2.300 1.5e-08
pancreatic ductal adenocarcinoma liver m... -1.089 1.7e-02
subependymal giant cell astrocytoma 1.132 2.6e-02
tuberculosis 1.400 1.5e-05

Gene RIF (4)

AA Sequence

MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALL      1 - 70
VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIG     71 - 140
TPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASF    141 - 210
SIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKY    211 - 280
PEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLH    281 - 350
KVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA    351 - 420
SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS                      421 - 472
//

Text Mined References (20)

PMID Year Title