Property Summary

NCBI Gene PubMed Count 15
Grant Count 7
R01 Count 4
Funding $8,012,066
PubMed Score 297.19
PubTator Score 1268.04

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
20802479 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MKFLIFAFFGGVHLLSLCSGKAICKNGISKRTFEEIKEEIASCGDVAKAIINLAVYGKAQNRSYERLALL      1 - 70
VDTVGPRLSGSKNLEKAIQIMYQNLQQDGLEKVHLEPVRIPHWERGEESAVMLEPRIHKIAILGLGSSIG     71 - 140
TPPEGITAEVLVVTSFDELQRRASEARGKIVVYNQPYINYSRTVQYRTQGAVEAAKVGALASLIRSVASF    141 - 210
SIYSPHTGIQEYQDGVPKIPTACITVEDAEMMSRMASHGIKIVIQLKMGAKTYPDTDSFNTVAEITGSKY    211 - 280
PEQVVLVSGHLDSWDVGQGAMDDGGGAFISWEALSLIKDLGLRPKRTLRLVLWTAEEQGGVGAFQYYQLH    281 - 350
KVNISNYSLVMESDAGTFLPTGLQFTGSEKARAIMEEVMSLLQPLNITQVLSHGEGTDINFWIQAGVPGA    351 - 420
SLLDDLYKYFFFHHSHGDTMTVMDPKQMNVAAAVWAVVSYVVADMEEMLPRS                      421 - 472
//

Text Mined References (19)

PMID Year Title
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23725790 2013 GWAS of DNA methylation variation within imprinting control regions suggests parent-of-origin association.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
20802479 2010 Genome-wide association study of migraine implicates a common susceptibility variant on 8q22.1.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17214548 2007 Presence of the propeptide on recombinant lysosomal dipeptidase controls both activation and dimerization.
More...