Property Summary

NCBI Gene PubMed Count 8
Grant Count 16
R01 Count 9
Funding $838,321.98
PubMed Score 1.57
PubTator Score 1.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.100 0.000
ovarian cancer 1.200 0.000

AA Sequence

MSRARGALCRACLALAAALAALLLLPLPLPRAPAPARTPAPAPRAPPSRPAAPSLRPDDVFIAVKTTRKN      1 - 70
HGPRLRLLLRTWISRARQQTFIFTDGDDPELELQGGDRVINTNCSAVRTRQALCCKMSVEYDKFIESGRK     71 - 140
WFCHVDDDNYVNARSLLHLLSSFSPSQDVYLGRPSLDHPIEATERVQGGRTVTTVKFWFATGGAGFCLSR    141 - 210
GLALKMSPWASLGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLS    211 - 280
HGGPENPHNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTSR                       281 - 331
//

Text Mined References (9)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11165380 2001 Radical fringe negatively modulates Notch signaling in postmitotic neurons of the rat brain.
10341080 1999 Genomic structure, mapping, and expression analysis of the mammalian Lunatic, Manic, and Radical fringe genes.
9187150 1997 A family of mammalian Fringe genes implicated in boundary determination and the Notch pathway.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.