Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.57
PubTator Score 1.14

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 8.4e-06
psoriasis 6694 3.5e-04
Disease Target Count Z-score Confidence
Alagille syndrome 15 3.465 1.7
Papillary renal cell carcinoma 9 3.303 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.200 8.4e-06
psoriasis 1.100 3.5e-04

AA Sequence

MSRARGALCRACLALAAALAALLLLPLPLPRAPAPARTPAPAPRAPPSRPAAPSLRPDDVFIAVKTTRKN      1 - 70
HGPRLRLLLRTWISRARQQTFIFTDGDDPELELQGGDRVINTNCSAVRTRQALCCKMSVEYDKFIESGRK     71 - 140
WFCHVDDDNYVNARSLLHLLSSFSPSQDVYLGRPSLDHPIEATERVQGGRTVTTVKFWFATGGAGFCLSR    141 - 210
GLALKMSPWASLGSFMSTAEQVRLPDDCTVGYIVEGLLGARLLHSPLFHSHLENLQRLPPDTLLQQVTLS    211 - 280
HGGPENPHNVVNVAGGFSLHQDPTRFKSIHCLLYPDTDWCPRQKQGAPTSR                       281 - 331
//

Text Mined References (9)

PMID Year Title