Property Summary

NCBI Gene PubMed Count 13
PubMed Score 211.57
PubTator Score 93.60

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.100 1.1e-03
astrocytic glioma -1.500 3.7e-03
atypical teratoid / rhabdoid tumor -1.400 2.6e-05
dermatomyositis 1.700 3.9e-04
ependymoma -1.400 9.1e-03
glioblastoma -1.100 1.0e-02
group 3 medulloblastoma -1.300 4.5e-03
lung cancer -1.100 4.0e-03
medulloblastoma, large-cell -2.000 4.5e-05
oligodendroglioma -1.300 2.5e-18
osteosarcoma 1.550 1.1e-06
ovarian cancer -2.000 3.6e-04
Pick disease -1.100 2.3e-02
primitive neuroectodermal tumor -1.200 6.5e-06
psoriasis 1.300 2.5e-04

Gene RIF (5)

AA Sequence

MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVN      1 - 70
RAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQA     71 - 140
TISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRA    141 - 210
EDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPM    211 - 280
DIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEI    281 - 350
IILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN                          351 - 398
//

Text Mined References (17)

PMID Year Title