Property Summary

NCBI Gene PubMed Count 12
PubMed Score 206.10
PubTator Score 93.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
oligodendroglioma 2849 2.53728921035199E-18
medulloblastoma 1524 1.02379910099294E-7
osteosarcoma 7933 1.05358729933348E-6
primitive neuroectodermal tumor 3031 6.52825783039048E-6
atypical teratoid / rhabdoid tumor 4369 2.64670481083142E-5
medulloblastoma, large-cell 6234 4.47205712516167E-5
psoriasis 6685 2.4619532469554E-4
glioblastoma 5572 3.3807918292208E-4
ovarian cancer 8492 3.58680519590557E-4
dermatomyositis 967 3.92097942001941E-4
adult high grade glioma 2148 0.00112538029078638
astrocytic glioma 2241 0.0037402319336126
lung cancer 4473 0.00404429661054164
ependymoma 2514 0.00913892021663225
Pick disease 1893 0.0228009682897872
Disease Target Count Z-score Confidence
Polycythemia 19 4.303 2.2

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma -1.500 0.004
ependymoma -1.400 0.009
psoriasis 1.300 0.000
glioblastoma -1.300 0.000
oligodendroglioma -1.300 0.000
osteosarcoma 1.550 0.000
medulloblastoma -1.600 0.000
atypical teratoid / rhabdoid tumor -1.400 0.000
medulloblastoma, large-cell -2.000 0.000
primitive neuroectodermal tumor -1.200 0.000
lung cancer -1.100 0.004
adult high grade glioma -1.100 0.001
Pick disease -1.100 0.023
ovarian cancer -2.000 0.000
dermatomyositis 1.700 0.000

Synonym

Accession Q9Y639 B2RAL7 B7Z4D3 B7ZLL2 Q17R52 Q59EJ9 Q6NVX7 Q9Y640
Symbols GP55
GP65
SDR1
np55
np65
SDFR1

Gene

  Ortholog (12)

Gene RIF (4)

PMID Text
25040546 correct synaptic membrane protein localization, neuronal energy supply, expression of LTP and LTD, animal and human behaviour, and pathophysiology and disease--{review}
24514566 This study showed that Single nucleotide polymorphism in the neuroplastin locus associates with cortical thickness and intellectual ability in adolescents.
17196182 In human brain np65 is prominently present in cerebellum while np55 is the predominant isoform in mouse and rat cerebellum.
17123723 NPTN may be involved in genetic susceptibility to schizophrenia.

AA Sequence

MSGSSLPSALALSLLLVSGSLLPGPGAAQNAGFVKSPMSETKLTGDAFELYCDVVGSPTPEIQWWYAEVN      1 - 70
RAESFRQLWDGARKRRVTVNTAYGSNGVSVLRITRLTLEDSGTYECRASNDPKRNDLRQNPSITWIRAQA     71 - 140
TISVLQKPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTKNGVELSATRKNASNMEYRINKPRA    141 - 210
EDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRKKENGMPM    211 - 280
DIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSASVVTVLRVRSHLAPLWPFLGILAEI    281 - 350
IILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRNTN                          351 - 398
//

Text Mined References (16)

PMID Year Title
25040546 2014 The Neuroplastin adhesion molecules: key regulators of neuronal plasticity and synaptic function.
24514566 2015 Single nucleotide polymorphism in the neuroplastin locus associates with cortical thickness and intellectual ability in adolescents.
21269460 2011 Initial characterization of the human central proteome.
19581412 2009 Quantitative proteomics identifies a Dab2/integrin module regulating cell migration.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
17196182 2007 The immunolocalization of the synaptic glycoprotein neuroplastin differs substantially between the human and the rodent brain.
17123723 2007 Association study of putative promoter polymorphisms in the neuroplastin gene and schizophrenia.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
More...