Property Summary

NCBI Gene PubMed Count 31
PubMed Score 21.90
PubTator Score 14.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count
Omodysplasia 1 1

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma 1.300 5.5e-04
Astrocytoma, Pilocytic 1.100 3.4e-03
atypical teratoid / rhabdoid tumor 1.800 3.5e-04
cystic fibrosis 1.946 5.5e-07
glioblastoma 1.400 6.7e-04
group 3 medulloblastoma 2.700 6.7e-06
intraductal papillary-mucinous neoplasm ... -2.300 2.3e-02
invasive ductal carcinoma 1.607 4.4e-05
medulloblastoma, large-cell 2.500 2.5e-03
osteosarcoma 3.005 2.3e-05
pancreatic ductal adenocarcinoma liver m... -1.369 1.5e-02
pituitary cancer 1.200 1.4e-02
primitive neuroectodermal tumor 1.300 4.2e-02
psoriasis -1.600 6.0e-08

Gene RIF (9)

AA Sequence

MPSWIGAVILPLLGLLLSLPAGADVKARSCGEVRQAYGAKGFSLADIPYQEIAGEHLRICPQEYTCCTTE      1 - 70
MEDKLSQQSKLEFENLVEETSHFVRTTFVSRHKKFDEFFRELLENAEKSLNDMFVRTYGMLYMQNSEVFQ     71 - 140
DLFTELKRYYTGGNVNLEEMLNDFWARLLERMFQLINPQYHFSEDYLECVSKYTDQLKPFGDVPRKLKIQ    141 - 210
VTRAFIAARTFVQGLTVGREVANRVSKVSPTPGCIRALMKMLYCPYCRGLPTVRPCNNYCLNVMKGCLAN    211 - 280
QADLDTEWNLFIDAMLLVAERLEGPFNIESVMDPIDVKISEAIMNMQENSMQVSAKVFQGCGQPKPAPAL    281 - 350
RSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEE    351 - 420
ECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSD    421 - 490
ESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSSAAQRGHSLLSWSLTCIVLALQRLCR         491 - 555
//

Text Mined References (32)

PMID Year Title