Property Summary

NCBI Gene PubMed Count 108
PubMed Score 350.96
PubTator Score 1128.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 6.76671320364543E-9
malignant mesothelioma 3163 1.41240495726761E-5
medulloblastoma, large-cell 6234 1.25776460649385E-4
lung cancer 4473 0.0264520817514014
Disease Target Count Z-score Confidence
MEDNIK syndrome 8 3.187 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -2.650 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer -1.100 0.026

Synonym

Accession Q9Y624 B7Z941 JAM-A
Symbols JAM
KAT
JAM1
JAMA
JCAM
CD321
PAM-1

Gene

PANTHER Protein Class (1)

PDB

1NBQ   3EOY   3TSZ   4ODB  

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid

Gene RIF (71)

PMID Text
26513296 Data indicate that junctional adhesion molecule-A (JAM-A) is overexpressed in multiple myeloma (MM) cells and regulates reovirus sensitivity in MM.
26306570 JAM-A regulates the planar orientation of the mitotic spindle during epithelial morphogenesis. It triggers transient activation of Cdc42 and PI3K, generates a gradient of PtdIns(3,4,5)P3 at the cortex and regulates the formation of the actin cytoskeleton.
25994236 JAM-A up-regulation can increase the proliferation, cytokine secretion and wound-homing ability of MSCs, thus accelerating the repair rate of full-thickness skin defects
25916097 JAM-A promotes proliferation and inhibits apoptosis of gastric cancer, suggesting that it has a pivotal role in gastric cancer progression.
25471296 RNA interference mediated JAM-A gene silencing promotes human epidermal stem cell proliferation.
25420915 CD14(+)CD16(+) monocytes selectively transmigrated across our BBB model as a result of their increased JAM-A and ALCAM expression.
25416560 Junctional adhesion molecule-A, an epithelial-mesenchymal transition inducer, correlates with metastasis in nasopharyngeal cancer.
25070379 Data indicate that junctional adhesion molecule A (JAM-A) is a potential target of microRNA-495 {miR-495) in breast cancer cells.
25033702 Low JAM-A expression correlates with poor clinical outcome and promotes cell migration and invasion in gastric cancer.
24704627 Redistribution of JAM-A in endothelial cells after stimulation with pro-atherogenic oxidized lipoproteins results in increased transmigration of mononuclear cells.
More...

AA Sequence

MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT      1 - 70
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP     71 - 140
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY    141 - 210
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY    211 - 280
SQPSARSEGEFKQTSSFLV                                                       281 - 299
//

Text Mined References (120)

PMID Year Title
26513296 2015 Junctional adhesion molecule-A is overexpressed in advanced multiple myeloma and determines response to oncolytic reovirus.
26306570 2015 JAM-A regulates cortical dynein localization through Cdc42 to control planar spindle orientation during mitosis.
25994236 2015 JAM-A promotes wound healing by enhancing both homing and secretory activities of mesenchymal stem cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916097 Junctional adhesion molecule-A promotes proliferation and inhibits apoptosis of gastric cancer.
25481868 2015 The tight junction protein JAM-A functions as coreceptor for rotavirus entry into MA104 cells.
25471296 2015 RNA interference mediated JAM-A gene silencing promotes human epidermal stem cell proliferation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25420915 2015 JAM-A and ALCAM are therapeutic targets to inhibit diapedesis across the BBB of CD14+CD16+ monocytes in HIV-infected individuals.
25416956 2014 A proteome-scale map of the human interactome network.
More...