Property Summary

NCBI Gene PubMed Count 108
Grant Count 137
R01 Count 91
Funding $18,374,737.27
PubMed Score 350.96
PubTator Score 1128.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.100 0.000
osteosarcoma -2.650 0.000
medulloblastoma, large-cell -1.100 0.000
lung cancer -1.100 0.026

Synonym

Accession Q9Y624 B7Z941 JAM-A
Symbols JAM
KAT
JAM1
JAMA
JCAM
CD321
PAM-1

Gene

PANTHER Protein Class (1)

PDB

1NBQ   3EOY   3TSZ   4ODB  

Gene RIF (71)

PMID Text
26513296 Data indicate that junctional adhesion molecule-A (JAM-A) is overexpressed in multiple myeloma (MM) cells and regulates reovirus sensitivity in MM.
26306570 JAM-A regulates the planar orientation of the mitotic spindle during epithelial morphogenesis. It triggers transient activation of Cdc42 and PI3K, generates a gradient of PtdIns(3,4,5)P3 at the cortex and regulates the formation of the actin cytoskeleton.
25994236 JAM-A up-regulation can increase the proliferation, cytokine secretion and wound-homing ability of MSCs, thus accelerating the repair rate of full-thickness skin defects
25916097 JAM-A promotes proliferation and inhibits apoptosis of gastric cancer, suggesting that it has a pivotal role in gastric cancer progression.
25471296 RNA interference mediated JAM-A gene silencing promotes human epidermal stem cell proliferation.
25420915 CD14(+)CD16(+) monocytes selectively transmigrated across our BBB model as a result of their increased JAM-A and ALCAM expression.
25416560 Junctional adhesion molecule-A, an epithelial-mesenchymal transition inducer, correlates with metastasis in nasopharyngeal cancer.
25070379 Data indicate that junctional adhesion molecule A (JAM-A) is a potential target of microRNA-495 {miR-495) in breast cancer cells.
25033702 Low JAM-A expression correlates with poor clinical outcome and promotes cell migration and invasion in gastric cancer.
24704627 Redistribution of JAM-A in endothelial cells after stimulation with pro-atherogenic oxidized lipoproteins results in increased transmigration of mononuclear cells.
More...

AA Sequence

MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT      1 - 70
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP     71 - 140
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY    141 - 210
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY    211 - 280
SQPSARSEGEFKQTSSFLV                                                       281 - 299
//

Text Mined References (120)

PMID Year Title
26513296 2015 Junctional adhesion molecule-A is overexpressed in advanced multiple myeloma and determines response to oncolytic reovirus.
26306570 2015 JAM-A regulates cortical dynein localization through Cdc42 to control planar spindle orientation during mitosis.
25994236 2015 JAM-A promotes wound healing by enhancing both homing and secretory activities of mesenchymal stem cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25916097 Junctional adhesion molecule-A promotes proliferation and inhibits apoptosis of gastric cancer.
25481868 2015 The tight junction protein JAM-A functions as coreceptor for rotavirus entry into MA104 cells.
25471296 2015 RNA interference mediated JAM-A gene silencing promotes human epidermal stem cell proliferation.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25420915 2015 JAM-A and ALCAM are therapeutic targets to inhibit diapedesis across the BBB of CD14+CD16+ monocytes in HIV-infected individuals.
25416956 2014 A proteome-scale map of the human interactome network.
More...