Property Summary

NCBI Gene PubMed Count 119
PubMed Score 379.99
PubTator Score 1128.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 6.8e-09
malignant mesothelioma 3232 1.4e-05
medulloblastoma, large-cell 6241 1.3e-04
lung cancer 4740 2.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
MEDNIK syndrome 8 3.127 1.6
Cancer 2499 3.004 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.100 2.6e-02
malignant mesothelioma 1.100 1.4e-05
medulloblastoma, large-cell -1.100 1.3e-04
osteosarcoma -2.650 6.8e-09

Gene RIF (83)

AA Sequence

MGTKAQVERKLLCLFILAILLCSLALGSVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTT      1 - 70
RLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIP     71 - 140
SSATIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKSTRAFSNSSYVLNPTTGELVFDPLSASDTGEY    141 - 210
SCEARNGYGTPMTSNAVRMEAVERNVGVIVAAVLVTLILLGILVFGIWFAYSRGHFDRTKKGTSSKKVIY    211 - 280
SQPSARSEGEFKQTSSFLV                                                       281 - 299
//

Text Mined References (131)

PMID Year Title