Property Summary

NCBI Gene PubMed Count 37
Grant Count 60
R01 Count 55
Funding $4,857,606.31
PubMed Score 27.05
PubTator Score 20.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Nijmegen breakage syndrome 23 3.276 1.6

Expression

Gene RIF (19)

PMID Text
26431531 Patients with expression of both FEN1 and RAD54B were prone to have advanced nodal involvement and significantly poor prognosis.
26046797 RAD54B expression has potential to serve as a novel prognostic biomarker, particularly for distant recurrence in colorectal cancer
25765654 support a model in which RAD54L and RAD54B counteract genome-destabilizing effects of direct binding of RAD51 to dsDNA in tumor cells
25384516 The scaffolding function of Rad54B dynamically regulates the maintenance of genome integrity by limiting checkpoint strength.
24002644 RAD54B-deficient cells are selectively killed relative to controls via siRNA-based silencing of SOD1
23876972 RAD54B and GREB1 gene polymorphisms may not be associated with PCOS in the Han Chinese population.
20687897 These results suggest that hINO80 assists double-strand break repair by positively regulating the expression of the Rad54B and XRCC3 genes.
20610542 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
19690177 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MRRSAAPSQLQGNSFKKPKFIPPGRSNPGLNEEITKLNPDIKLFEGVAINNTFLPSQNDLRICSLNLPSE      1 - 70
ESTREINNRDNCSGKYCFEAPTLATLDPPHTVHSAPKEVAVSKEQEEKSDSLVKYFSVVWCKPSKKKHKK     71 - 140
WEGDAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEVMGVISPDDFSSGRCFQL    141 - 210
GGGSTAISHSSQVARKCFSNPFKSVCKPSSKENRQNDFQNCKPRHDPYTPNSLVMPRPDKNHQWVFNKNC    211 - 280
FPLVDVVIDPYLVYHLRPHQKEGIIFLYECVMGMRMNGRCGAILADEMGLGKTLQCISLIWTLQCQGPYG    281 - 350
GKPVIKKTLIVTPGSLVNNWKKEFQKWLGSERIKIFTVDQDHKVEEFIKSIFYSVLIISYEMLLRSLDQI    351 - 420
KNIKFDLLICDEGHRLKNSAIKTTTALISLSCEKRIILTGTPIQNDLQEFFALIDFVNPGILGSLSSYRK    421 - 490
IYEEPIILSREPSASEEEKELGERRAAELTCLTGLFILRRTQEIINKYLPPKIENVVFCRPGALQIELYR    491 - 560
KLLNSQVVRFCLQGLLENSPHLICIGALKKLCNHPCLLFNSIKEKECSSTCDKNEEKSLYKGLLSVFPAD    561 - 630
YNPLLFTEKESGKLQVLSKLLAVIHELRPTEKVVLVSNYTQTLNILQEVCKRHGYAYTRLDGQTPISQRQ    631 - 700
QIVDGFNSQHSSFFIFLLSSKAGGVGLNLIGGSHLILYDIDWNPATDIQAMSRVWRDGQKYPVHIYRLLT    701 - 770
TGTIEEKIYQRQISKQGLCGAVVDLTKTSEHIQFSVEELKNLFTLHESSDCVTHDLLDCECTGEEVHTGD    771 - 840
SLEKFIVSRDCQLGPHHQKSNSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT    841 - 910
//

Publication (40)

PMID Year Title
26431531 2015 The Overexpression of FEN1 and RAD54B May Act as Independent Prognostic Factors of Lung Adenocarcinoma.
26046797 2015 High RAD54B expression: an independent predictor of postoperative distant recurrence in colorectal cancer patients.
25930971 2015 A homozygous mutation in SLC1A4 in siblings with severe intellectual disability and microcephaly.
25765654 2015 RAD54 family translocases counter genotoxic effects of RAD51 in human tumor cells.
25384516 2014 Rad54B serves as a scaffold in the DNA damage response that limits checkpoint strength.
24002644 2013 Synthetic lethal targeting of superoxide dismutase 1 selectively kills RAD54B-deficient colorectal cancer cells.
23876972 2013 Replication study of RAD54B and GREB1 polymorphisms and risk of PCOS in Han Chinese.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20687897 2010 Human INO80 chromatin-remodelling complex contributes to DNA double-strand break repair via the expression of Rad54B and XRCC3 genes.
20610542 2010 Gamma-radiation sensitivity and polymorphisms in RAD51L1 modulate glioma risk.
More...