Property Summary

NCBI Gene PubMed Count 25
PubMed Score 161.48
PubTator Score 42.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
HHH syndrome 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Ornithine translocase deficiency 7 7.824 3.9

Expression

Protein-protein Interaction (2)

Gene RIF (13)

AA Sequence

MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPA      1 - 70
LIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEM     71 - 140
ETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPV    141 - 210
PLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPAN    211 - 280
GALFLAYEYSRKLMMNQLEAY                                                     281 - 301
//

Text Mined References (29)

PMID Year Title