Property Summary

NCBI Gene PubMed Count 139
Grant Count 502
R01 Count 255
Funding $83,321,729.53
PubMed Score 578.06
PubTator Score 226.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis -1.200 0.000
astrocytoma 1.900 0.000
juvenile dermatomyositis -1.068 0.000
pancreatic ductal adenocarcinoma liver m... 1.244 0.005
ovarian cancer 2.600 0.000

Synonym

Accession Q9Y618 O00613 O15416 O15421 Q13354 Q56D06 Q59GM0 Q9Y5U0 N-CoR2
Symbols SMRT
TRAC
CTG26
SMRTE
TRAC1
N-CoR2
TNRC14
TRAC-1
SMAP270
SMRTE-tau

Gene

PDB

1KKQ   1R2B   1XC5   2GPV   2L5G   2LTP   2ODD   2RT5   3R29   3R2A   4A69   4OAR  

Protein-protein Interaction (3)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
504787 screening 164 / 0 / 199 Counterscreen for agonists of nuclear receptor subfamily 2, group E, member 3 (NR2E3): TR-FRET-based biochemical high throughput assay to identify agonists of the interaction between peroxisome proliferator-activated receptor gamma (PPARg) and nuclear receptor co-repressor 2 (NCOR2)

Gene RIF (78)

PMID Text
26836265 this study identifies NCOR2 as a new gene for FVC, indicating the importance of further research into the role of vitamin A intake/supplementation and its interactions with related genes in the regulation of FVC.
26161557 Molecular basis for the specific interactions between HDAC4 and the SMRT corepressor.
26055705 A repeated peptide motif present in both SMRT and NCoR is sufficient to mediate specific interaction, with micromolar affinity, with all the Class IIa Histone Deacetylases (HDACs 4, 5, 7, and 9).
25953768 SNPs in Notch pathway genes may be predictors of cutaneous melanoma disease-specific survival.
25821969 Significant methylation changes in the SLC23A2 and NCOR2 regulatory regions.
24971610 SMRT enhances cell growth of estrogen receptor-alpha-positive breast cancer cells by promotion of cell cycle progression and inhibition of apoptosis.
24449765 model where p53 binding to the SMRT deacetylase activation domain (DAD) limits HDAC3 interaction with this coregulator, thereby facilitating SMRT coactivation of p53-dependent gene expression
24268649 Phosphorylation of the CK2 site on SMRT significantly increased affinity for SHARP.
23861398 a model in which TNFalpha-induced beta-TrCP1 accumulation promotes SMRT degradation and the subsequent induction of proinflammatory gene expression.
23690919 SMRT is responsible for basal repression of Wip1,a phosphatase that de-phosphorylates and inactivates Chk2, thus affecting a feedback loop responsible for licensing the correct timing of Chk2 activation and the proper execution of the DNA repair process.
More...

AA Sequence

MSGSTQPVAQTWRATEPRYPPHSLSYPVQIARTHTDVGLLEYQHHSRDYASHLSPGSIIQPQRRRPSLLS      1 - 70
EFQPGNERSQELHLRPESHSYLPELGKSEMEFIESKRPRLELLPDPLLRPSPLLATGQPAGSEDLTKDRS     71 - 140
LTGKLEPVSPPSPPHTDPELELVPPRLSKEELIQNMDRVDREITMVEQQISKLKKKQQQLEEEAAKPPEP    141 - 210
EKPVSPPPIESKHRSLVQIIYDENRKKAEAAHRILEGLGPQVELPLYNQPSDTRQYHENIKINQAMRKKL    211 - 280
ILYFKRRNHARKQWEQKFCQRYDQLMEAWEKKVERIENNPRRRAKESKVREYYEKQFPEIRKQRELQERM    281 - 350
QSRVGQRGSGLSMSAARSEHEVSEIIDGLSEQENLEKQMRQLAVIPPMLYDADQQRIKFINMNGLMADPM    351 - 420
KVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASFLERKTVAECVLYYYLTKKNENYKSLVRRSYRRR    421 - 490
GKSQQQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLLKEKTDDTSGEDNDE    491 - 560
KEAVASKGRKTANSQGRRKGRITRSMANEANSEEAITPQQSAELASMELNESSRWTEEEMETAKKGLLEH    561 - 630
GRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKMEKERNARRKKKKAPAAASEEAAFPPVV    631 - 700
EDEEMEASGVSGNEEEMVEEAEALHASGNEVPRGECSGPATVNNSSDTESIPSPHTEAAKDTGQNGPKPP    701 - 770
ATLGADGPPPGPPTPPPEDIPAPTEPTPASEATGAPTPPPAPPSPSAPPPVVPKEEKEEETAAAPPVEEG    771 - 840
EEQKPPAAEELAVDTGKAEEPVKSECTEEAEEGPAKGKDAEAAEATAEGALKAEKKEGGSGRATTAKSSG    841 - 910
APQDSDSSATCSADEVDEAEGGDKNRLLSPRPSLLTPTGDPRANASPQKPLDLKQLKQRAAAIPPIQVTK    911 - 980
VHEPPREDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPRGKSRSPAPPADKEAEKPVFFPAFAAEAQKL    981 - 1050
PGDPPCWTSGLPFPVPPREVIKASPHAPDPSAFSYAPPGHPLPLGLHDTARPVLPRPPTISNPPPLISSA   1051 - 1120
KHPSVLERQIGAISQGMSVQLHVPYSEHAKAPVGPVTMGLPLPMDPKKLAPFSGVKQEQLSPRGQAGPPE   1121 - 1190
SLGVPTAQEASVLRGTALGSVPGGSITKGIPSTRVPSDSAITYRGSITHGTPADVLYKGTITRIIGEDSP   1191 - 1260
SRLDRGREDSLPKGHVIYEGKKGHVLSYEGGMSVTQCSKEDGRSSSGPPHETAAPKRTYDMMEGRVGRAI   1261 - 1330
SSASIEGLMGRAIPPERHSPHHLKEQHHIRGSITQGIPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRD   1331 - 1400
LTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQGTPLKYDTG   1401 - 1470
ASTTGSKKHDVRSLIGSPGRTFPPVHPLDVMADARALERACYEESLKSRPGTASSSGGSIARGAPVIVPE   1471 - 1540
LGKPRQSPLTYEDHGAPFAGHLPRGSPVTTREPTPRLQEGSLSSSKASQDRKLTSTPREIAKSPHSTVPE   1541 - 1610
HHPHPISPYEHLLRGVSGVDLYRSHIPLAFDPTSIPRGIPLDAAAAYYLPRHLAPNPTYPHLYPPYLIRG   1611 - 1680
YPDTAALENRQTIINDYITSQQMHHNAATAMAQRADMLRGLSPRESSLALNYAAGPRGIIDLSQVPHLPV   1681 - 1750
LVPPTPGTPATAMDRLAYLPTAPQPFSSRHSSSPLSPGGPTHLTKPTTTSSSERERDRDRERDRDREREK   1751 - 1820
SILTSTTTVEHAPIWRPGTEQSSGSSGSSGGGGGSSSRPASHSHAHQHSPISPRTQDALQQRPSVLHNTG   1821 - 1890
MKGIITAVEPSTPTVLRSTSTSSPVRPAATFPPATHCPLGGTLDGVYPTLMEPVLLPKEAPRVARPERPR   1891 - 1960
ADTGHAFLAKPPARSGLEPASSPSKGSEPRPLVPPVSGHATIARTPAKNLAPHHASPDPPAPPASASDPH   1961 - 2030
REKTQSKPFSIQELELRSLGYHGSSYSPEGVEPVSPVSSPSLTHDKGLPKHLEELDKSHLEGELRPKQPG   2031 - 2100
PVKLGGEAAHLPHLRPLPESQPSSSPLLQTAPGVKGHQRVVTLAQHISEVITQDYTRHHPQQLSAPLPAP   2101 - 2170
LYSFPGASCPVLDLRRPPSDLYLPPPDHGAPARGSPHSEGGKRSPEPNKTSVLGGGEDGIEPVSPPEGMT   2171 - 2240
EPGHSRSAVYPLLYRDGEQTEPSRMGSKSPGNTSQPPAFFSKLTESNSAMVKSKKQEINKKLNTHNRNEP   2241 - 2310
EYNISQPGTEIFNMPAITGTGLMTYRSQAVQEHASTNMGLEAIIRKALMGKYDQWEESPPLSANAFNPLN   2311 - 2380
ASASLPAAMPITAADGRSDHTLTSPGGGGKAKVSGRPSSRKAKSPAPGLASGDRPPSVSSVHSEGDCNRR   2381 - 2450
TPLTNRVWEDRPSSAGSTPFPYNPLIMRLQAGVMASPPPPGLPAGSGPLAGPHHAWDEEPKPLLCSQYET   2451 - 2520
LSDSE                                                                    2521 - 2525
//

Publication (158)

PMID Year Title
26836265 2016 Association of Forced Vital Capacity with the Developmental Gene NCOR2.
26161557 2015 Mutagenesis Study Reveals the Rim of Catalytic Entry Site of HDAC4 and -5 as the Major Binding Surface of SMRT Corepressor.
26055705 2015 Insights into the Recruitment of Class IIa Histone Deacetylases (HDACs) to the SMRT/NCoR Transcriptional Repression Complex.
25953768 2015 Functional Variants in Notch Pathway Genes NCOR2, NCSTN, and MAML2 Predict Survival of Patients with Cutaneous Melanoma.
25821969 2015 Methylation levels of SLC23A2 and NCOR2 genes correlate with spinal muscular atrophy severity.
24971610 2014 The SMRT coregulator enhances growth of estrogen receptor-?-positive breast cancer cells by promotion of cell cycle progression and inhibition of apoptosis.
24667120 2014 Genome-wide association study identifies new disease loci for isolated clubfoot.
24449765 2014 Activation of p53 transcriptional activity by SMRT: a histone deacetylase 3-independent function of a transcriptional corepressor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24268649 2014 Structural insights into the recruitment of SMRT by the corepressor SHARP under phosphorylative regulation.
More...