Property Summary

NCBI Gene PubMed Count 18
PubMed Score 176.44
PubTator Score 94.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.1
Cardiovascular system disease 246 0.0 0.9
Disease Target Count Z-score Confidence
Serine deficiency 9 5.708 2.9
Cancer 2499 3.373 1.7

Expression

  Differential Expression (30)

Disease log2 FC p
active Crohn's disease 1.654 4.9e-02
active ulcerative colitis 1.919 3.6e-02
Astrocytoma, Pilocytic 1.400 3.0e-03
atypical teratoid / rhabdoid tumor 1.700 4.3e-03
colon cancer 2.500 3.1e-04
cystic fibrosis -1.221 2.8e-03
Down syndrome 1.900 2.7e-04
ependymoma 2.400 2.4e-08
gastric cancer 1.700 2.3e-04
group 3 medulloblastoma -1.600 6.2e-04
hepatocellular carcinoma 1.500 4.4e-06
intraductal papillary-mucinous adenoma (... -3.800 1.3e-03
lung adenocarcinoma 1.100 1.3e-08
lung cancer 2.300 3.6e-04
lung carcinoma 1.500 3.3e-07
malignant mesothelioma 2.200 1.1e-07
medulloblastoma, large-cell 1.200 2.7e-03
MYELODYSPLASTIC SYNDROME -1.700 3.3e-02
nasopharyngeal carcinoma 1.600 6.8e-03
non-small cell lung cancer 2.266 4.2e-18
oligodendroglioma 1.500 2.9e-02
osteosarcoma 3.249 3.9e-06
ovarian cancer 1.400 4.1e-07
pancreatic cancer 2.400 3.5e-03
pancreatic carcinoma 2.400 3.5e-03
pancreatic ductal adenocarcinoma liver m... -3.292 1.3e-03
Polycystic ovary syndrome -1.818 3.1e-02
psoriasis 1.200 1.0e-04
subependymal giant cell astrocytoma -2.331 1.5e-02
X-linked cerebral adrenoleukodystrophy 1.200 4.2e-02

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (10)

AA Sequence

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY      1 - 70
KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW     71 - 140
NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV    141 - 210
IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE    211 - 280
IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT    281 - 350
IEDVQKLAAFMKKFLEMHQL                                                      351 - 370
//

Text Mined References (23)

PMID Year Title