Property Summary

NCBI Gene PubMed Count 17
PubMed Score 167.36
PubTator Score 94.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 5.43017360731827E-30
lung adenocarcinoma 2714 9.7898945494407E-12
posterior fossa group B ependymoma 1530 8.86484463811279E-11
ovarian cancer 8492 6.27582806219564E-8
malignant mesothelioma 3163 1.08907252444774E-7
lung carcinoma 2844 3.32079452690107E-7
primary pancreatic ductal adenocarcinoma 1271 2.11187154219266E-6
osteosarcoma 7933 3.85791200291065E-6
hepatocellular carcinoma 550 4.36573126418024E-6
group 4 medulloblastoma 1875 1.01778424688841E-5
pancreatic cancer 2300 4.3932255576265E-5
psoriasis 6685 1.01375712187382E-4
gastric cancer 436 2.31774753644797E-4
Down syndrome 548 2.72474221581839E-4
colon cancer 1475 3.09675487187309E-4
lung cancer 4473 7.45098507780391E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00126640165329891
medulloblastoma, large-cell 6234 0.0026806144835472
cystic fibrosis 1670 0.00280979696410108
pilocytic astrocytoma 3086 0.00293143177297824
pancreatic carcinoma 567 0.00351091777223151
atypical teratoid / rhabdoid tumor 4369 0.00429880732198901
nasopharyngeal carcinoma 1056 0.00677530842846633
subependymal giant cell astrocytoma 2287 0.0146849333191211
oligodendroglioma 2849 0.0294200008807392
Polycystic Ovary Syndrome 335 0.0312387929010723
MYELODYSPLASTIC SYNDROME 39 0.0333322202797504
active ulcerative colitis 477 0.0357101834013162
X-linked cerebral adrenoleukodystrophy 115 0.0416426966623319
active Crohn's disease 918 0.0487437097472241
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 1.0

Expression

Synonym

Accession Q9Y617 Q5T7G5 Q5T7G6 Q96AW2 Q9BQ12
Symbols PSA
EPIP
NLS2
PSAT
PSATD

Gene

PANTHER Protein Class (2)

PDB

3E77  

  Ortholog (15)

 GWAS Trait (1)

Gene RIF (9)

PMID Text
26439504 High expression of PSAT is associated with Colon Cancer.
25152457 phosphoserine aminotransferase deficiency is associated with Neu-Laxova syndrome.
25142862 PSAT1 expression positively correlates with the levels of phosphorylated cyclin D1 in non-small cell lung cancer.
23166591 Expression of HIV-1 Tat upregulates the abundance of phosphoserine aminotransferase 1 (PSAT1) in the nucleoli of Jurkat T-cells
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22190034 Expression of HIV-1 Tat upregulates the abundance of phosphoserine aminotransferase 1 (PSAT1) in the nucleoli of Jurkat T-cells
20955740 we propose an idea that PSAT1 may be implicated in altered serine metabolism and schizophrenia spectrum conditions.
18221502 Overexpression of phosphoserine aminotransferase is associated with colorectal cancer development
12633500 nucleotide sequence and enzymatic activity of two isoforms generated by alternative splicing; differential expression depending upon tissue specificity and cellular proliferation status

AA Sequence

MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNY      1 - 70
KVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTW     71 - 140
NLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVV    141 - 210
IVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYE    211 - 280
IIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVT    281 - 350
IEDVQKLAAFMKKFLEMHQL                                                      351 - 370
//

Text Mined References (22)

PMID Year Title
26439504 2015 Clinical Implication of Serine Metabolism-Associated Enzymes in Colon Cancer.
25152457 2014 Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway.
25142862 2015 PSAT1 regulates cyclin D1 degradation and sustains proliferation of non-small cell lung cancer cells.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21269460 2011 Initial characterization of the human central proteome.
20955740 2011 A novel balanced chromosomal translocation found in subjects with schizophrenia and schizotypal personality disorder: altered l-serine level associated with disruption of PSAT1 gene expression.
More...