Property Summary

NCBI Gene PubMed Count 54
Grant Count 73
R01 Count 52
Funding $4,938,928.7
PubMed Score 75.74
PubTator Score 50.55

Knowledge Summary

Patent (6,334)



Accession Q9Y616 B4DQ57 IRAK-3
Symbols ASRT5


  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GO Component (2)

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (48)

26309029 Alpha-Melanocyte-Stimulating Hormone Suppresses TLR2-Mediated Functional Responses through IRAK-M in Normal Human Keratinocytes
25852282 IRAK3 methylation was associated with tumor stage and poor prognosis of hepatocellular carcinoma patients.
25746953 HIF1alpha is a regulator of monocyte functional re-programming in sepsis via regulating IRAKM expression.
25595781 IRAK-M expression is upregulated in peripheral blood cells from idiopathic pulmonary fibrosis patients
25481771 The structure function of the death domain of human IRAK-M
24074582 These data indicate the enhancing effect of IRAK-M on epithelial human rhinovirus-16 infection, which is partly through the autophagic pathway.
23588345 our study demonstrates that patients carrying IRAK-M+22148 G haplotype are more susceptible to sepsis than patients carrying IRAK-M+22148 A haplotype, suggesting that IRAK-M+22148 G haplotype might be a risk factor for sepsis.
23376919 IRAK-M mediates TLR7-induced MEKK3-dependent second wave NFjB activation to produce inhibitory molecules
22886503 these data identify an important signaling regulator in human macrophages that is used by surfactant to control the long-term alveolar inflammatory response, i.e., enhanced IRAK-M activity.
22634523 the tested variations of IRAK-M and SIGIRR genes do not confer a relevant role in the susceptibility to systemic lupus erythematosus in European-descent populations

AA Sequence

IDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE                                      561 - 596

Text Mined References (57)

PMID Year Title
26309029 2015 The Alpha-Melanocyte-Stimulating Hormone Suppresses TLR2-Mediated Functional Responses through IRAK-M in Normal Human Keratinocytes.
25852282 2015 Methylation of IRAK3 is a novel prognostic marker in hepatocellular carcinoma.
25746953 2015 Human monocytes undergo functional re-programming during sepsis mediated by hypoxia-inducible factor-1?.
25595781 2015 IRAK-M promotes alternative macrophage activation and fibroproliferation in bleomycin-induced lung injury.
25481771 2014 The structure function of the death domain of human IRAK-M.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24074582 2013 Interleukin-1 receptor-associated kinase M (IRAK-M) promotes human rhinovirus infection in lung epithelial cells via the autophagic pathway.
23588345 2013 Association between gene polymorphisms of IRAK-M and the susceptibility of sepsis.
23376919 2013 IRAK-M mediates Toll-like receptor/IL-1R-induced NF?B activation and cytokine production.
22886503 2012 Pulmonary surfactant protein A and surfactant lipids upregulate IRAK-M, a negative regulator of TLR-mediated inflammation in human macrophages.