Property Summary

Ligand Count 4
NCBI Gene PubMed Count 56
PubMed Score 83.98
PubTator Score 50.55

Knowledge Summary

Patent (6,334)

Expression

  Differential Expression (27)

Disease log2 FC p
active Crohn's disease 3.605 7.7e-03
adrenocortical carcinoma -1.392 1.5e-04
Astrocytoma, Pilocytic 1.400 4.0e-04
Breast cancer -2.800 2.4e-02
diabetes mellitus -1.100 2.2e-02
ductal carcinoma in situ -1.500 1.2e-02
gastric carcinoma 1.400 4.4e-02
group 3 medulloblastoma -1.100 1.7e-02
hepatocellular carcinoma 1.100 6.9e-05
intraductal papillary-mucinous adenoma (... 1.800 4.7e-03
intraductal papillary-mucinous neoplasm ... 2.200 5.9e-03
invasive ductal carcinoma -1.900 1.1e-02
lung adenocarcinoma -1.100 1.1e-05
lung cancer -3.300 2.9e-05
lung carcinoma -3.300 1.4e-26
malignant mesothelioma -5.700 1.1e-09
medulloblastoma, large-cell -1.800 6.3e-06
non-small cell lung cancer -1.706 1.5e-14
osteosarcoma -1.001 2.8e-02
ovarian cancer -2.900 4.6e-14
pancreatic cancer 1.300 2.5e-03
pancreatic carcinoma 1.300 2.5e-03
pituitary cancer -1.600 1.3e-09
psoriasis -1.400 7.4e-03
Rheumatoid arthritis 1.900 4.8e-02
tuberculosis and treatment for 6 months -1.200 4.7e-03
ulcerative colitis 2.400 3.4e-09

 GO Component (2)

 GWAS Trait (1)

Protein-protein Interaction (6)

Gene RIF (50)

AA Sequence

MAGNCGARGALSAHTLLFDLPPALLGELCAVLDSCDGALGWRGLAERLSSSWLDVRHIEKYVDQGKSGTR      1 - 70
ELLWSWAQKNKTIGDLLQVLQEMGHRRAIHLITNYGAVLSPSEKSYQEGGFPNILFKETANVTVDNVLIP     71 - 140
EHNEKGILLKSSISFQNIIEGTRNFHKDFLIGEGEIFEVYRVEIQNLTYAVKLFKQEKKMQCKKHWKRFL    141 - 210
SELEVLLLFHHPNILELAAYFTETEKFCLIYPYMRNGTLFDRLQCVGDTAPLPWHIRIGILIGISKAIHY    211 - 280
LHNVQPCSVICGSISSANILLDDQFQPKLTDFAMAHFRSHLEHQSCTINMTSSSSKHLWYMPEEYIRQGK    281 - 350
LSIKTDVYSFGIVIMEVLTGCRVVLDDPKHIQLRDLLRELMEKRGLDSCLSFLDKKVPPCPRNFSAKLFC    351 - 420
LAGRCAATRAKLRPSMDEVLNTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL    421 - 490
PSDEGLRIDRMTQKTPFECSQSEVMFLSLDKKPESKRNEEACNMPSSSCEESWFPKYIVPSQDLRPYKVN    491 - 560
IDPSSEAPGHSCRSRPVESSCSSKFSWDEYEQYKKE                                      561 - 596
//

Text Mined References (59)

PMID Year Title