Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.26
PubTator Score 3.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Riley-Day syndrome 8 3.978 2.0
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.132 0.002

Gene RIF (3)

PMID Text
22386842 Anti-ACTL7a antibodies may cause infertility in mice because the in vitro treatment of mouse spermatozoa with ACTL7a antibody-containing serum markedly reduced the fertilizing potential of the spermatozoa.
21278383 Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
18720898 The researchers found the 9q31 region is associated with adult height variation.

AA Sequence

MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTK      1 - 70
AVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGII     71 - 140
VDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYG    141 - 210
RTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC    211 - 280
FVALDPIEEKKVPLSEHTIRYVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIAL    281 - 350
KRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDTPQVNVLPERDSAVWTGGSILASLQGFQPLWVHRF    351 - 420
EYEEHGPFFLYRRCF                                                           421 - 435
//

Text Mined References (14)

PMID Year Title
22386842 2012 Anti-ACTL7a antibodies: a cause of infertility.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21278383 2011 Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
21263130 2011 Novel breast cancer susceptibility locus at 9q31.2: results of a genome-wide association study.
18720898 2008 Applying novel genome-wide linkage strategies to search for loci influencing type 2 diabetes and adult height in American Samoa.
17644991 2007 Single nucleotide polymorphisms: discovery of the genetic causes of male infertility.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12695497 2003 The conformational state of Tes regulates its zyxin-dependent recruitment to focal adhesions.
More...