Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.32
PubTator Score 3.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Riley-Day syndrome 11 3.887 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.132 1.6e-03

Gene RIF (3)

AA Sequence

MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTK      1 - 70
AVVVDLGTGYCKCGFAGLPRPTHKISTTVGKPYMETAKTGDNRKETFVGQELNNTNVHLKLVNPLRHGII     71 - 140
VDWDTVQDIWEYLFRQEMKIAPEEHAVLVSDPPLSPHTNREKYAEMLFEAFNTPAMHIAYQSRLSMYSYG    141 - 210
RTSGLVVEVGHGVSYVVPIYEGYPLPSITGRLDYAGSDLTAYLLGLLNSAGNEFTQDQMGIVEDIKKKCC    211 - 280
FVALDPIEEKKVPLSEHTIRYVLPDGKEIQLCQERFLCSEMFFKPSLIKSMQLGLHTQTVSCLNKCDIAL    281 - 350
KRDLMGNILLCGGSTMLSGFPNRLQKELSSMCPNDTPQVNVLPERDSAVWTGGSILASLQGFQPLWVHRF    351 - 420
EYEEHGPFFLYRRCF                                                           421 - 435
//

Text Mined References (14)

PMID Year Title