Property Summary

NCBI Gene PubMed Count 39
Grant Count 23
R01 Count 17
Funding $1,466,841.93
PubMed Score 37.30
PubTator Score 37.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
non-small cell lung cancer -1.047 0.000
subependymal giant cell astrocytoma 1.119 0.036
lung carcinoma -1.200 0.000
spina bifida 1.099 0.040

Gene RIF (23)

PMID Text
25555464 Immunostaining of sections of hearts with both anti-FHOD1 antibodies confirmed the presence of FHOD1 in intercalated discs and double immunostaining demonstrated its colocalisation with cadherin, plakoglobin and shifted localization to connexin43.
25125170 Report FODH1 expression in cardiomyocytes and increased expression in dilated cardiommyopathy.
24880667 the diaphanous formin FHOD1 as an interaction partner of N2G
24481812 FHOD1 promotes formation of short actin filaments and transiently associates with transverse arcs providing tight temporal and spatial control of the formation and turnover of transverse arcs into mature ventral stress fibers during dynamic cell behavior.
24086398 FHOD1 participates in cytoskeletal changes in epithelial-mesenchymal transition.
23613471 Cdh1 contributes to spatiotemporal organization of AurB activity, and organization of FHOD1 activity by AurB contributes to daughter cell spreading after mitosis.
23444374 FHOD1 stabilizes actin filaments by protecting barbed ends from depolymerization with its dimeric FH2 domain, whereas the region N-terminal to the FH1 domain mediates F-actin bundling by simultaneously binding to the sides of adjacent F-actin filaments.
22490440 SIRPalpha/CD172a and FHOD1 are unique markers of littoral cells, a recently evolved major cell population of red pulp of human spleen.
22144583 FHOD1 and PPM1F (direct regulators of the actin cytoskeleton) were identified as novel targets of miR-200c. Expression levels of FHOD1 and PPM1F were inversely correlated with miR-200c level in breast cancer cell lines and breast cancer patient samples.
21605332 Letter: G-protein coupled and ITAM receptor regulation of the formin FHOD1 through Rho kinase in platelets.
More...

AA Sequence

MAGGEDRGDGEPVSVVTVRVQYLEDTDPFACANFPEPRRAPTCSLDGALPLGAQIPAVHRLLGAPLKLED      1 - 70
CALQVSPSGYYLDTELSLEEQREMLEGFYEEISKGRKPTLILRTQLSVRVNAILEKLYSSSGPELRRSLF     71 - 140
SLKQIFQEDKDLVPEFVHSEGLSCLIRVGAAADHNYQSYILRALGQLMLFVDGMLGVVAHSDTIQWLYTL    141 - 210
CASLSRLVVKTALKLLLVFVEYSENNAPLFIRAVNSVASTTGAPPWANLVSILEEKNGADPELLVYTVTL    211 - 280
INKTLAALPDQDSFYDVTDALEQQGMEALVQRHLGTAGTDVDLRTQLVLYENALKLEDGDIEEAPGAGGR    281 - 350
RERRKPSSEEGKRSRRSLEGGGCPARAPEPGPTGPASPVGPTSSTGPALLTGPASSPVGPPSGLQASVNL    351 - 420
FPTISVAPSADTSSERSIYKARFLENVAAAETEKQVALAQGRAETLAGAMPNEAGGHPDARQLWDSPETA    421 - 490
PAARTPQSPAPCVLLRAQRSLAPEPKEPLIPASPKAEPIWELPTRAPRLSIGDLDFSDLGEDEDQDMLNV    491 - 560
ESVEAGKDIPAPSPPLPLLSGVPPPPPLPPPPPIKGPFPPPPPLPLAAPLPHSVPDSSALPTKRKTVKLF    561 - 630
WRELKLAGGHGVSASRFGPCATLWASLDPVSVDTARLEHLFESRAKEVLPSKKAGEGRRTMTTVLDPKRS    631 - 700
NAINIGLTTLPPVHVIKAALLNFDEFAVSKDGIEKLLTMMPTEEERQKIEEAQLANPDIPLGPAENFLMT    701 - 770
LASIGGLAARLQLWAFKLDYDSMEREIAEPLFDLKVGMEQLVQNATFRCILATLLAVGNFLNGSQSSGFE    771 - 840
LSYLEKVSEVKDTVRRQSLLHHLCSLVLQTRPESSDLYSEIPALTRCAKVDFEQLTENLGQLERRSRAAE    841 - 910
ESLRSLAKHELAPALRARLTHFLDQCARRVAMLRIVHRRVCNRFHAFLLYLGYTPQAAREVRIMQFCHTL    911 - 980
REFALEYRTCRERVLQQQQKQATYRERNKTRGRMITETEKFSGVAGEAPSNPSVPVAVSSGPGRGDADSH    981 - 1050
ASMKSLLTSRPEDTTHNRRSRGMVQSSSPIMPTVGPSTASPEEPPGSSLPSDTSDEIMDLLVQSVTKSSP   1051 - 1120
RALAARERKRSRGNRKSLRRTLKSGLGDDLVQALGLSKGPGLEV                             1121 - 1164
//

Publication (48)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25555464 2015 Distribution of formins in cardiac muscle: FHOD1 is a component of intercalated discs and costameres.
25125170 2014 The formin FHOD1 in cardiomyocytes.
24880667 2014 FHOD1 interaction with nesprin-2G mediates TAN line formation and nuclear movement.
24481812 2014 FHOD1 regulates stress fiber organization by controlling the dynamics of transverse arcs and dorsal fibers.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24086398 2013 FHOD1, a formin upregulated in epithelial-mesenchymal transition, participates in cancer cell migration and invasion.
23613471 2013 Spatiotemporal organization of Aurora-B by APC/CCdh1 after mitosis coordinates cell spreading through FHOD1.
23444374 2013 FHOD1 is a combined actin filament capping and bundling factor that selectively associates with actin arcs and stress fibers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...