Property Summary

NCBI Gene PubMed Count 16
PubMed Score 4.88
PubTator Score 4.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 1.7
Disease Target Count Z-score Confidence
Lynch syndrome 35 3.445 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 1.5e-02
intraductal papillary-mucinous neoplasm ... 1.600 1.8e-02
medulloblastoma, large-cell -1.700 1.2e-05
oligodendroglioma 1.200 2.7e-02
osteosarcoma -2.383 8.5e-07
ovarian cancer -1.200 1.6e-05
psoriasis -2.900 1.3e-05

Gene RIF (6)

AA Sequence

MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKEYSLHSFDRKWG      1 - 70
QIQKWLEDSERARYSHRSSHHRPYLGVEDALSIRSVGSHRYDMFKDRSSRLSSLNHSYSHSHGMKKRSSD     71 - 140
SHKDLLSGLYFDQRNYSSLRHSKPTSAYYTRQSSSLYSDPLATYKSDRASPTANSGLLRSASLASLYNGG    141 - 210
LYNPYGPRTPSECSYYSSRISSARSSPGFTNDDTASIVSSDRASRGRRESVVSAADYFSRSNRRGSVVSE    211 - 280
VDDISIPDLSSLDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRDIYDL    281 - 350
KDQIQDVEGRYMQGLKELKESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRE    351 - 420
NEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEEKQRMQQKIDTMTKEVFDLQETLLWKDKKIGAL    421 - 490
EKQKEYIACLRNERDMLREELADLQETVKTGEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLES    491 - 560
AGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQI    561 - 630
SEYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTN    631 - 700
SHLAKRLEKMKANRTALLAQQ                                                     701 - 721
//

Text Mined References (29)

PMID Year Title