Property Summary

NCBI Gene PubMed Count 14
Grant Count 1
R01 Count 1
Funding $36,250
PubMed Score 4.22
PubTator Score 4.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.400 0.015
oligodendroglioma 1.200 0.027
psoriasis -2.900 0.000
osteosarcoma -2.383 0.000
medulloblastoma, large-cell -1.700 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.018
ovarian cancer -1.200 0.000

Gene RIF (6)

PMID Text
23036196 FATylation of LRRFIP2 occurs on two distinct sites, each being modified by a single FAT10 moiety.
21785361 A novel exonic rearrangement affecting MLH1 and the contiguous LRRFIP2 is a founder mutation in Portuguese Lynch syndrome families
21220426 Unambiguous characterization of site-specific phosphorylation of leucine-rich repeat Fli-I-interacting protein 2 (LRRFIP2) in Toll-like receptor 4 (TLR4)-mediated signaling.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19265123 LRR-binding MyD88 interactor LRRFIP2 is a positive regulator of NF-kappa B activity and is also a positive regulator of cytokine production in lipopolysaccharide-stimulated macrophages, suggesting a functional role in TLR4-mediated inflammatory response.
15677333 These data suggest that LRRFIP2 plays an important role in transducing Wnt signals.

AA Sequence

MGTPASGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKEYSLHSFDRKWG      1 - 70
QIQKWLEDSERARYSHRSSHHRPYLGVEDALSIRSVGSHRYDMFKDRSSRLSSLNHSYSHSHGMKKRSSD     71 - 140
SHKDLLSGLYFDQRNYSSLRHSKPTSAYYTRQSSSLYSDPLATYKSDRASPTANSGLLRSASLASLYNGG    141 - 210
LYNPYGPRTPSECSYYSSRISSARSSPGFTNDDTASIVSSDRASRGRRESVVSAADYFSRSNRRGSVVSE    211 - 280
VDDISIPDLSSLDEKSDKQYAENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRDIYDL    281 - 350
KDQIQDVEGRYMQGLKELKESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRE    351 - 420
NEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEEKQRMQQKIDTMTKEVFDLQETLLWKDKKIGAL    421 - 490
EKQKEYIACLRNERDMLREELADLQETVKTGEKHGLVIIPDGTPNGDVSHEPVAGAITVVSQEAAQVLES    491 - 560
AGEGPLDVRLRKLAGEKEELLSQIRKLKLQLEEERQKCSRNDGTVGDLAGLQNGSDLQFIEMQRDANRQI    561 - 630
SEYKFKLSKAEQDITTLEQSISRLEGQVLRYKTAAENAEKVEDELKAEKRKLQRELRTALDKIEEMEMTN    631 - 700
SHLAKRLEKMKANRTALLAQQ                                                     701 - 721
//

Publication (27)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942110 2013 LRRFIP2 negatively regulates NLRP3 inflammasome activation in macrophages by promoting Flightless-I-mediated caspase-1 inhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23036196 2012 Modification of the inflammatory mediator LRRFIP2 by the ubiquitin-like protein FAT10 inhibits its activity during cellular response to LPS.
21785361 2011 A novel exonic rearrangement affecting MLH1 and the contiguous LRRFIP2 is a founder mutation in Portuguese Lynch syndrome families.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21220426 2011 Unambiguous characterization of site-specific phosphorylation of leucine-rich repeat Fli-I-interacting protein 2 (LRRFIP2) in Toll-like receptor 4 (TLR4)-mediated signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...