Property Summary

NCBI Gene PubMed Count 17
PubMed Score 46.40
PubTator Score 24.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
breast carcinoma 1.100 1.8e-02
colon cancer 1.400 4.0e-03
lung cancer 1.200 5.4e-04
malignant mesothelioma 1.300 8.4e-06
ovarian cancer 1.500 4.4e-05
psoriasis 1.400 3.5e-04

Gene RIF (7)

AA Sequence

MGLQLRALLGAFGRWTLRLGPRPSCSPRMAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLK      1 - 70
SGGDEERREKPPKRKIVLLMAYSGKGYHGMQRNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQ     71 - 140
RCARTDKGVSAAGQVVSLKVWLIDDILEKINSHLPSHIRILGLKRVTGGFNSKNRCDARTYCYLLPTFAF    141 - 210
AHKDRDVQDETYRLSAETLQQVNRLLACYKGTHNFHNFTSQKGPQDPSACRYILEMYCEEPFVREGLEFA    211 - 280
VIRVKGQSFMMHQIRKMVGLVVAIVKGYAPESVLERSWGTEKVDVPKAPGLGLVLERVHFEKYNQRFGND    281 - 350
GLHEPLDWAQEEGKVAAFKEEHIYPTIIGTERDERSMAQWLSTLPIHNFSATALTAGGTGAKVPSPLEGS    351 - 420
EGDGDTD                                                                   421 - 427
//

Text Mined References (28)

PMID Year Title