Property Summary

NCBI Gene PubMed Count 17
Grant Count 3
Funding $146,293.08
PubMed Score 5.06
PubTator Score 9.98

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
lung adenocarcinoma -1.500 0.000
ovarian cancer -1.500 0.000

Gene RIF (2)

PMID Text
20108251 The results suggest that nucleus-localized Sedlin may play a role in regulation of transcriptional activities of the MRG family of transcription factors via binding to PAM14.
17008723 identify MRG15 residues that form a shallow hydrophobic pocket to interact with the N-terminal 50 residues of PAM14 through primarily hydrophobic interactions.

AA Sequence

MRPLDIVELAEPEEVEVLEPEEDFEQFLLPVINEMREDIASLTREHGRAYLRNRSKLWEMDNMLIQIKTQ      1 - 70
VEASEESALNHLQNPGDAAEGRAAKRCEKAEEKAKEIAKMAEMLVELVRRIEKSESS                  71 - 127
//

Text Mined References (19)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
23455924 2013 A Y2H-seq approach defines the human protein methyltransferase interactome.
22038470 2012 Characterization of MRFAP1 turnover and interactions downstream of the NEDD8 pathway.
21873567 2011 Quantitative proteomic analysis of cellular protein modulation upon inhibition of the NEDD8-activating enzyme by MLN4924.
21269460 2011 Initial characterization of the human central proteome.
20562209 2010 A viral vaccine encoding prostate-specific antigen induces antigen spreading to a common set of self-proteins in prostate cancer patients.
20108251 2010 Interaction of Sedlin with PAM14.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17008723 2006 The MRG domain of human MRG15 uses a shallow hydrophobic pocket to interact with the N-terminal region of PAM14.
More...