Property Summary

NCBI Gene PubMed Count 13
PubMed Score 35.47
PubTator Score 21.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.1e-03
active Crohn's disease 922 6.3e-03
sarcoidosis 370 1.4e-02
active ulcerative colitis 764 1.4e-02
Multiple Sclerosis 540 1.6e-02
Disease Target Count Z-score Confidence
Retinitis pigmentosa 4 38 3.016 1.5

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease 1.042 6.3e-03
active ulcerative colitis 1.466 1.4e-02
Multiple Sclerosis 1.900 1.6e-02
osteosarcoma -1.131 4.1e-03
sarcoidosis 1.300 1.4e-02

Gene RIF (3)

AA Sequence

MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY      1 - 70
SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP     71 - 140
VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA    141 - 210
MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS    211 - 280
RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP             281 - 341
//

Text Mined References (13)

PMID Year Title