Property Summary

NCBI Gene PubMed Count 13
PubMed Score 36.93
PubTator Score 21.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 0.00407947020849375
sarcoidosis 368 0.00603803486534165
active Crohn's disease 918 0.00705855530468058
active ulcerative colitis 477 0.0143948562604459
Multiple Sclerosis 498 0.015652785387554

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.131 0.004
active Crohn's disease 1.674 0.007
active ulcerative colitis 1.466 0.014
Multiple Sclerosis 1.900 0.016
sarcoidosis 1.800 0.006

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG Inparanoid

Gene RIF (3)

PMID Text
26335051 TEL2 plays a key role in nasopharyngeal carcinoma metastasis by directly down-regulating SERPINE1.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
15743832 Human TEL2 augments the proliferation and survival of normal mouse B cells and dramatically accelerates lymphoma development in Emu-Myc transgenic mice.

AA Sequence

MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEY      1 - 70
SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSP     71 - 140
VPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPA    141 - 210
MPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMS    211 - 280
RALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP             281 - 341
//

Text Mined References (13)

PMID Year Title
26335051 2015 TEL2 suppresses metastasis by down-regulating SERPINE1 in nasopharyngeal carcinoma.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15743832 2005 The novel ETS factor TEL2 cooperates with Myc in B lymphomagenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12588862 2003 The human L(3)MBT polycomb group protein is a transcriptional repressor and interacts physically and functionally with TEL (ETV6).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11108721 2001 Tel-2 is a novel transcriptional repressor related to the Ets factor Tel/ETV-6.
More...