Property Summary

NCBI Gene PubMed Count 9
PubMed Score 143.80
PubTator Score 33.71

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -2.800 4.3e-02
invasive ductal carcinoma -1.400 3.7e-04
medulloblastoma, large-cell -1.200 7.1e-03
oligodendroglioma 1.500 1.6e-03
ovarian cancer -1.200 8.9e-06
Pick disease -1.500 7.3e-05
progressive supranuclear palsy -1.400 1.8e-02
tuberculosis and treatment for 3 months 1.100 2.3e-06

Synonym

Accession Q9Y600 A8K0U4 Q4QQH9 Q9UNJ5 Q9Y601
Symbols CSD
PCAP

Gene

PANTHER Protein Class (2)

PDB

2JIS  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MADSEALPSLAGDPVAVEALLRAVFGVVVDEAIQKGTSVSQKVCEWKEPEELKQLLDLELRSQGESQKQI      1 - 70
LERCRAVIRYSVKTGHPRFFNQLFSGLDPHALAGRIITESLNTSQYTYEIAPVFVLMEEEVLRKLRALVG     71 - 140
WSSGDGIFCPGGSISNMYAVNLARYQRYPDCKQRGLRTLPPLALFTSKECHYSIQKGAAFLGLGTDSVRV    141 - 210
VKADERGKMVPEDLERQIGMAEAEGAVPFLVSATSGTTVLGAFDPLEAIADVCQRHGLWLHVDAAWGGSV    211 - 280
LLSQTHRHLLDGIQRADSVAWNPHKLLAAGLQCSALLLQDTSNLLKRCHGSQASYLFQQDKFYDVALDTG    281 - 350
DKVVQCGRRVDCLKLWLMWKAQGDQGLERRIDQAFVLARYLVEEMKKREGFELVMEPEFVNVCFWFVPPS    351 - 420
LRGKQESPDYHERLSKVAPVLKERMVKEGSMMIGYQPHGTRGNFFRVVVANSALTCADMDFLLNELERLG    421 - 490
QDL                                                                       491 - 493
//

Text Mined References (9)

PMID Year Title