Property Summary

NCBI Gene PubMed Count 34
Grant Count 5
R01 Count 5
Funding $416,825.5
PubMed Score 37.86
PubTator Score 48.65

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.000

Synonym

Accession Q9Y5Z9 B3KQG3 Q53GX3 Q5THD4
Symbols SCCD
TERE1

Gene

PANTHER Protein Class (1)

Gene RIF (26)

PMID Text
26890002 UBIAD1 or menaquinone-4 could decrease vascular cell differentiation and calcification, probably via its potent role of inversely modulating cellular cholesterol.
25874989 The conserved domain I is a substrate recognition site that undergoes a structural change after substrate binding.
25772619 results suggest that YY1 up-regulates UBIAD1 expression and UBIAD1 conversion activity through the UBIAD1 promoter
25742604 Data show that sterols stimulate binding of prenyltransferase UBIAD1 to HMG CoA reductase, which is subject to sterol-accelerated, endoplasmic reticulum (ER)-associated degradation augmented by the nonsterol isoprenoid geranylgeraniol.
24608252 N102S may also be a mutation hotspot in the Polish population, as in other previously reported populations.
23977195 Golgi localization of UBIAD1 influences its tumor suppressant activity.
23759948 Loss of TERE1 may contribute to the altered lipid metabolic phenotype associated with progression in renal clear cell carcinoma via an uncoupling of reactive oxygen species/nitric oxide and SXR signaling from apoptosis by elevation of cholesterol.
23564352 A TERE1-TBL2 complex likely functions in oxidative/nitrosative stress, lipid metabolism, and SXR signaling pathways in its role as a tumor suppressor.
23533172 UBIAD1-mediated vitamin K2 synthesis is required for vascular endothelial cell survival and development.
23374346 Findings identify UBIAD1 as a nonmitochondrial CoQ10-forming enzyme with specific cardiovascular protective function via the modulation of eNOS activity.
More...

AA Sequence

MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSA      1 - 70
LAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYT     71 - 140
LGCVCAACLYYLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSL    141 - 210
AIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCT    211 - 280
ISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI                281 - 338
//

Text Mined References (36)

PMID Year Title
26890002 2016 Role of UBIAD1 in Intracellular Cholesterol Metabolism and Vascular Cell Calcification.
25874989 2015 Functional characterization of the vitamin K2 biosynthetic enzyme UBIAD1.
25772619 2015 YY1 positively regulates human UBIAD1 expression.
25742604 2015 The prenyltransferase UBIAD1 is the target of geranylgeraniol in degradation of HMG CoA reductase.
24608252 2014 Phenotype-genotype correlation in patients with Schnyder corneal dystrophy.
24489112 2014 Recent trends in the metabolism and cell biology of vitamin K with special reference to vitamin K cycling and MK-4 biosynthesis.
23977195 2013 A novel Golgi retention signal RPWS for tumor suppressor UBIAD1.
23759948 2013 Ectopic expression of the TERE1 (UBIAD1) protein inhibits growth of renal clear cell carcinoma cells: altered metabolic phenotype associated with reactive oxygen species, nitric oxide and SXR target genes involved in cholesterol and lipid metabolism.
23564352 2013 The TERE1 protein interacts with mitochondrial TBL2: regulation of trans-membrane potential, ROS/RNS and SXR target genes.
23533172 2013 UBIAD1-mediated vitamin K2 synthesis is required for vascular endothelial cell survival and development.
More...