Property Summary

NCBI Gene PubMed Count 35
PubMed Score 42.47
PubTator Score 48.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
psoriasis 6694 4.5e-37
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Cystinosis 14 3.074 1.5
Disease Target Count
Schnyder Corneal Dystrophy 23

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 4.5e-37

Gene RIF (27)

AA Sequence

MAASQVLGEKINILSGETVKAGDRDPLGNDCPEQDRLPQRSWRQKCASYVLALRPWSFSASLTPVALGSA      1 - 70
LAYRSHGVLDPRLLVGCAVAVLAVHGAGNLVNTYYDFSKGIDHKKSDDRTLVDRILEPQDVVRFGVFLYT     71 - 140
LGCVCAACLYYLSPLKLEHLALIYFGGLSGSFLYTGGIGFKYVALGDLIILITFGPLAVMFAYAIQVGSL    141 - 210
AIFPLVYAIPLALSTEAILHSNNTRDMESDREAGIVTLAILIGPTFSYILYNTLLFLPYLVFSILATHCT    211 - 280
ISLALPLLTIPMAFSLERQFRSQAFNKLPQRTAKLNLLLGLFYVFGIILAPAGSLPKI                281 - 338
//

Text Mined References (37)

PMID Year Title