Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.45
PubTator Score 15.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 2.5e-02
invasive ductal carcinoma -1.400 3.8e-04
lung adenocarcinoma -1.300 1.5e-14
lung cancer -1.100 6.9e-03
malignant mesothelioma -2.400 1.3e-06
medulloblastoma, large-cell -1.500 6.9e-03
osteosarcoma -1.286 4.3e-03
ovarian cancer -1.800 6.1e-08
tuberculosis -1.100 7.7e-04

AA Sequence

MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPP      1 - 70
GCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCY     71 - 140
LFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIYCKKDSGSPKMYV    141 - 210
FGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEW    211 - 280
RCTSSFSYLNLDTTEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLW    281 - 350
YLDTEKPPAPSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQG    351 - 420
SNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPH    421 - 490
TSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAVVKDETSLTTFSTKSEVDETY    491 - 560
ALPATKISRVETHATATPFSKETPSNPVATVKAGERQWCDVGIFKNNTALVSQFYLLPKGKQSISKVGNA    561 - 630
DVPDYSLLKKQDLVPGTGYRFRVAAINGCGIGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPP    631 - 700
TSPSGNILEYSAYLAIRTAQIQDNPSQLVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNE    701 - 770
KGYGPATQVRWLQGNNKKAPLN                                                    771 - 792
//

Text Mined References (10)

PMID Year Title