Property Summary

NCBI Gene PubMed Count 7
PubMed Score 5.45
PubTator Score 15.86

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 1.47412032505885E-14
ovarian cancer 8492 6.07344270971735E-8
malignant mesothelioma 3163 1.29315540546151E-6
invasive ductal carcinoma 2950 3.79895427517111E-4
tuberculosis 1563 7.68476261058394E-4
osteosarcoma 7933 0.00432518100890905
lung cancer 4473 0.00686502220724063
medulloblastoma, large-cell 6234 0.00693290483890523
atypical teratoid / rhabdoid tumor 4369 0.0247854857422708
Disease Target Count Z-score Confidence
Botulism 20 4.42 2.2
Chagas disease 34 3.046 1.5

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -2.400 0.000
osteosarcoma -1.286 0.004
atypical teratoid / rhabdoid tumor -1.200 0.025
medulloblastoma, large-cell -1.500 0.007
tuberculosis -1.100 0.001
lung cancer -1.100 0.007
lung adenocarcinoma -1.300 0.000
invasive ductal carcinoma -1.400 0.000
ovarian cancer -1.800 0.000

Synonym

Accession Q9Y5Z7 B2R8Q5 C0H5X3 HCF-2
Symbols HCF2
HCF-2

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
C. elegans OMA EggNOG Inparanoid

AA Sequence

MAAPSLLNWRRVSSFTGPVPRARHGHRAVAIRELMIIFGGGNEGIADELHVYNTATNQWFLPAVRGDIPP      1 - 70
GCAAHGFVCDGTRILVFGGMVEYGRYSNELYELQASRWLWKKVKPHPPPSGLPPCPRLGHSFSLYGNKCY     71 - 140
LFGGLANESEDSNNNVPRYLNDFYELELQHGSGVVGWSIPVTKGVVPSPRESHTAVIYCKKDSGSPKMYV    141 - 210
FGGMCGARLDDLWQLDLETMSWSKPETKGTVPLPRSLHTASVIGNKMYIFGGWVPHKGENTETSPHDCEW    211 - 280
RCTSSFSYLNLDTTEWTTLVSDSQEDKKNSRPRPRAGHCAVAIGTRLYFWSGRDGYKKALNSQVCCKDLW    281 - 350
YLDTEKPPAPSQVQLIKATTNSFHVKWDEVSTVEGYLLQLSTDLPYQAASSDSSAAPNMQGVRMDPHRQG    351 - 420
SNNIVPNSINDTINSTKTEQPATKETSMKNKPDFKALTDSNAILYPSLASNASNHNSHVVDMLRKNEGPH    421 - 490
TSANVGVLSSCLDVRTVIPETSVSSTVSSTQTMVTQQTIKTESSSTNGAVVKDETSLTTFSTKSEVDETY    491 - 560
ALPATKISRVETHATATPFSKETPSNPVATVKAGERQWCDVGIFKNNTALVSQFYLLPKGKQSISKVGNA    561 - 630
DVPDYSLLKKQDLVPGTGYRFRVAAINGCGIGPFSKISEFKTCIPGFPGAPSAVRISKNVEGIHLSWEPP    631 - 700
TSPSGNILEYSAYLAIRTAQIQDNPSQLVFMRIYCGLKTSCIVTAGQLANAHIDYTSRPAIVFRISAKNE    701 - 770
KGYGPATQVRWLQGNNKKAPLN                                                    771 - 792
//

Text Mined References (9)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15199122 2004 Leukemia proto-oncoprotein MLL forms a SET1-like histone methyltransferase complex with menin to regulate Hox gene expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10196288 1999 Herpes simplex virus transactivator VP16 discriminates between HCF-1 and a novel family member, HCF-2.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.