Property Summary

NCBI Gene PubMed Count 8
PubMed Score 3.85
PubTator Score 3.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.5e-08
colon cancer 1478 4.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer -1.400 1.5e-08
colon cancer -1.200 4.4e-02

Gene RIF (6)

AA Sequence

MASKVSCLYVLTVVCWASALWYLSITRPTSSYTGSKPFSHLTVARKNFTFGNIRTRPINPHSFEFLINEP      1 - 70
NKCEKNIPFLVILISTTHKEFDARQAIRETWGDENNFKGIKIATLFLLGKNADPVLNQMVEQESQIFHDI     71 - 140
IVEDFIDSYHNLTLKTLMGMRWVATFCSKAKYVMKTDSDIFVNMDNLIYKLLKPSTKPRRRYFTGYVING    141 - 210
GPIRDVRSKWYMPRDLYPDSNYPPFCSGTGYIFSADVAELIYKTSLHTRLLHLEDVYVGLCLRKLGIHPF    211 - 280
QNSGFNHWKMAYSLCRYRRVITVHQISPEEMHRIWNDMSSKKHLRC                            281 - 326
//

Text Mined References (9)

PMID Year Title