Property Summary

NCBI Gene PubMed Count 47
PubMed Score 524.67
PubTator Score 302.18

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 8.76442259614824E-26
breast carcinoma 1614 1.91921133872422E-18
lung carcinoma 2844 5.58348367770919E-16
lung adenocarcinoma 2714 1.26271062998696E-13
ovarian cancer 8492 9.83152778492867E-11
colon cancer 1475 1.60119349467591E-7
lung cancer 4473 3.26393228146619E-6
Atopic dermatitis 944 6.80653947552787E-5
invasive ductal carcinoma 2950 8.37242124481417E-5
ductal carcinoma in situ 1745 2.90821229433913E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 5.54588282518327E-4
permanent atrial fibrillation 44 7.57158550423852E-4
group 3 medulloblastoma 2254 8.21618683026639E-4
limb girdle muscular dystrophy 2B 74 0.00106096347893967
interstitial cystitis 2299 0.00152663111424281
pancreatic cancer 2300 0.00202365356078687
psoriasis 6685 0.00343572976937107
osteosarcoma 7933 0.0071492151220183
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00978098817281592
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0101815891436507
non diabetic and post-ischemic heart failure 200 0.0141828034344411
Pick disease 1893 0.0174331031048728
pituitary cancer 1972 0.0181459373668272
adrenocortical carcinoma 1427 0.024149537276571
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0424355958952025
mucosa-associated lymphoid tissue lymphoma 480 0.0496852820275193

Expression

Synonym

Accession Q9Y5Y7 Q8TC18 Q9UNF4 LYVE-1
Symbols HAR
XLKD1
LYVE-1
CRSBP-1

Gene

  Ortholog (12)

Gene RIF (36)

PMID Text
26823460 These results demonstrate the prerequisite of a critical LYVE-1 threshold density and show that hyaluronan binding may be elicited in lymphatic endothelium by surface clustering with divalent LYVE-1 mAbs.
26352587 Data (including data from studies in knockout mice) suggest LYVE1 mediates adhesion of group A Streptococci (GAS) to lymphatic vesicular endothelium via capsular hyaluronan; this appears to be critical factor for lymphatic trafficking of GAS in vivo.
26240291 We have established a novel, three-protein biomarker panel that is able to detect patients with early-stage pancreatic cancer in urine specimens:LYVE-1, REG1A, and TFF1 were selected as candidate biomarkers
25318003 High expression of LYVE-1 is associated with atherosclerotic arteries.
25141859 High LYVE expression is associated with visceral pleural invasion and lymphatic thromboembolism in non-small-cell lung cancer.
23717428 High-low cell surface HA content of tumor cells through the interaction with LYVE-1 leads to adhesion differences.
23264596 FGF2 binds to LYVE-1 with a higher affinity than any other known LYVE-1-binding molecules, such as hyaluronan or PDGF-BB. Glycosylation of LYVE-1 is important for FGF2 binding.
22673514 CRSBP-1-associated fibrillar structures are identical to the ER network as evidenced by the co-localization of CRSBP-1 and BiP in these cells
22241180 LYVE-1 may have value as predictor of outcome in neuroblastoma
21974896 Data indicate that detection of lymphatic vascular invasion (LVI) can be optimized by specific D2-40 or LYVE-1 staining.
More...

AA Sequence

MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAG      1 - 70
KDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCI     71 - 140
PEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETS    141 - 210
TMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIET    211 - 280
KVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV                                281 - 322
//

Text Mined References (48)

PMID Year Title
26823460 2016 Binding of Hyaluronan to the Native Lymphatic Vessel Endothelial Receptor LYVE-1 Is Critically Dependent on Receptor Clustering and Hyaluronan Organization.
26352587 2015 Rapid Lymphatic Dissemination of Encapsulated Group A Streptococci via Lymphatic Vessel Endothelial Receptor-1 Interaction.
26240291 2015 Identification of a Three-Biomarker Panel in Urine for Early Detection of Pancreatic Adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25318003 2014 Arterial wall lymphangiogenesis is increased in the human iliac atherosclerotic arteries: involvement of CCR7 receptor.
25141859 2014 The effects of sonic hedgehog signaling pathway components on non-small-cell lung cancer progression and clinical outcome.
23717428 2013 The interaction between LYVE-1 with hyaluronan on the cell surface may play a role in the diversity of adhesion to cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264596 2013 Evidence for the interaction of fibroblast growth factor-2 with the lymphatic endothelial cell marker LYVE-1.
More...