Property Summary

NCBI Gene PubMed Count 47
Grant Count 88
R01 Count 50
Funding $10,444,843.78
PubMed Score 524.67
PubTator Score 302.18

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y5Y7 Q8TC18 Q9UNF4 LYVE-1
Symbols HAR
XLKD1
LYVE-1
CRSBP-1

Gene

Gene RIF (36)

PMID Text
26823460 These results demonstrate the prerequisite of a critical LYVE-1 threshold density and show that hyaluronan binding may be elicited in lymphatic endothelium by surface clustering with divalent LYVE-1 mAbs.
26352587 Data (including data from studies in knockout mice) suggest LYVE1 mediates adhesion of group A Streptococci (GAS) to lymphatic vesicular endothelium via capsular hyaluronan; this appears to be critical factor for lymphatic trafficking of GAS in vivo.
26240291 We have established a novel, three-protein biomarker panel that is able to detect patients with early-stage pancreatic cancer in urine specimens:LYVE-1, REG1A, and TFF1 were selected as candidate biomarkers
25318003 High expression of LYVE-1 is associated with atherosclerotic arteries.
25141859 High LYVE expression is associated with visceral pleural invasion and lymphatic thromboembolism in non-small-cell lung cancer.
23717428 High-low cell surface HA content of tumor cells through the interaction with LYVE-1 leads to adhesion differences.
23264596 FGF2 binds to LYVE-1 with a higher affinity than any other known LYVE-1-binding molecules, such as hyaluronan or PDGF-BB. Glycosylation of LYVE-1 is important for FGF2 binding.
22673514 CRSBP-1-associated fibrillar structures are identical to the ER network as evidenced by the co-localization of CRSBP-1 and BiP in these cells
22241180 LYVE-1 may have value as predictor of outcome in neuroblastoma
21974896 Data indicate that detection of lymphatic vascular invasion (LVI) can be optimized by specific D2-40 or LYVE-1 staining.
More...

AA Sequence

MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAG      1 - 70
KDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCI     71 - 140
PEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETS    141 - 210
TMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIET    211 - 280
KVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV                                281 - 322
//

Publication (48)

PMID Year Title
26823460 2016 Binding of Hyaluronan to the Native Lymphatic Vessel Endothelial Receptor LYVE-1 Is Critically Dependent on Receptor Clustering and Hyaluronan Organization.
26352587 2015 Rapid Lymphatic Dissemination of Encapsulated Group A Streptococci via Lymphatic Vessel Endothelial Receptor-1 Interaction.
26240291 2015 Identification of a Three-Biomarker Panel in Urine for Early Detection of Pancreatic Adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25318003 2014 Arterial wall lymphangiogenesis is increased in the human iliac atherosclerotic arteries: involvement of CCR7 receptor.
25141859 2014 The effects of sonic hedgehog signaling pathway components on non-small-cell lung cancer progression and clinical outcome.
23717428 2013 The interaction between LYVE-1 with hyaluronan on the cell surface may play a role in the diversity of adhesion to cancer cells.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264596 2013 Evidence for the interaction of fibroblast growth factor-2 with the lymphatic endothelial cell marker LYVE-1.
More...