Property Summary

NCBI Gene PubMed Count 52
PubMed Score 557.46
PubTator Score 302.18

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Gene RIF (41)

AA Sequence

MARCFSLVLLLTSIWTTRLLVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAG      1 - 70
KDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCI     71 - 140
PEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETS    141 - 210
TMSTETEPFVENKAAFKNEAAGFGGVPTALLVLALLFFGAAAGLGFCYVKRYVKAFPFTNKNQQKEMIET    211 - 280
KVVKEEKANDSNPNEESKKTDKNPEESKSPSKTTVRCLEAEV                                281 - 322
//

Text Mined References (53)

PMID Year Title