Property Summary

Ligand Count 224
NCBI Gene PubMed Count 111
PubMed Score 338.28
PubTator Score 166.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis 1.100 2.3e-03
ductal carcinoma in situ 1.100 1.4e-03
interstitial cystitis -1.100 2.9e-04
intraductal papillary-mucinous carcinoma... 1.300 9.8e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.9e-03
invasive ductal carcinoma 1.100 9.4e-03
lung adenocarcinoma 1.200 1.6e-09
lung cancer 1.100 4.5e-02
non-small cell lung cancer 1.122 1.2e-12
osteosarcoma -1.127 1.3e-02
pancreatic cancer 1.100 1.9e-05
pancreatic ductal adenocarcinoma liver m... 1.419 7.7e-03
psoriasis 1.200 4.3e-04

Gene RIF (99)

AA Sequence

MGSDRARKGGGGPKDFGAGLKYNSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAAVLIGLLLVLL      1 - 70
GIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKE     71 - 140
SAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVMLPPRARSLKSFVVTSVVAFPTDSKTVQRTQ    141 - 210
DNSCSFGLHARGVELMRFTTPGFPDSPYPAHARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVTVYN    211 - 280
TLSPMEPHALVQLCGTYPPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGT    281 - 350
FNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKDYVEINGEKYCGERSQFVVTS    351 - 420
NSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDHSDELNCSCDA    421 - 490
GHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSKSQQCNGKDDCGDGSDEASCP    491 - 560
KVNVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQV    561 - 630
SLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISH    631 - 700
PFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRV    701 - 770
INQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT    771 - 840
RLPLFRDWIKENTGV                                                           841 - 855
//

Text Mined References (113)

PMID Year Title