Property Summary

NCBI Gene PubMed Count 104
Grant Count 271
R01 Count 60
Funding $89,295,753.78
PubMed Score 322.14
PubTator Score 166.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9Y5Y6 Q9BS01 Q9H3S0 Q9HB36 Q9HCA3
Symbols HAI
MTSP1
SNC19
ARCI11
MT-SP1
PRSS14
TADG15
TMPRSS14

Gene

PDB

1EAW   1EAX   2FMV   2GV6   2GV7   3BN9   3NCL   3NPS   3P8F   3P8G   3SO3   4IS5   4ISL   4ISN   4ISO   4JYT   4JZ1   4JZI   4O97   4O9V  

Gene RIF (92)

PMID Text
26513078 Given that matriptase-1 participates in terminal KC differentiation, its absence in psoriatic skin lesions indicates that this contributes to the barrier disturbances in this disease.
26157007 Novel findings reveal a new paradigm in matriptase activation involving PDGF-D-specific signal transduction leading to extracellular acidosis.
25873032 Maritriptase is required for pro-HGF/c-Met signaling and cell proliferation in breast cancer cells.
25786220 Matriptase inhibition by HAI-2 requires the translocation of HAI-2 to the cell surface, a process which is observed in some breast cancer cells but not in mammary epithelial cells.
25730905 prostate cancer cell invasion is stimulated by a rapid but sustained increase in Src activity, mediated non-genomically by cytoplasmic AR, leading to rapid activation and shedding of the laminin protease Matriptase
24705933 Matriptase can act as a cellular sensor of the chemical environment of the cell that allows the cell to respond to and protect itself from changes in the chemical milieu.
24696092 Report potent/specific inhibition of matriptase by the cyclic microprotein MCoTI-II.
24617769 It presents evidence that matriptase efficiently cleaves the HR1 portion of gp41 into a 22-residue chemotactic peptide MAT-1, the sequence of which is highly conserved across HIV-1 clades.
24617769 Matriptase, a serine protease, efficiently cleaves the HR1 portion of HIV-1 gp41 into a 22-residue chemotactic peptide MAT-1, leading to chemotaxis by using FPR2 in primary neutrophils
24382204 Matriptase expression correlates with tumour progression and invasive capability in oral squamous cell carcinoma
More...

AA Sequence

MGSDRARKGGGGPKDFGAGLKYNSRHEKVNGLEEGVEFLPVNNVKKVEKHGPGRWVVLAAVLIGLLLVLL      1 - 70
GIGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKE     71 - 140
SAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVMLPPRARSLKSFVVTSVVAFPTDSKTVQRTQ    141 - 210
DNSCSFGLHARGVELMRFTTPGFPDSPYPAHARCQWALRGDADSVLSLTFRSFDLASCDERGSDLVTVYN    211 - 280
TLSPMEPHALVQLCGTYPPSYNLTFHSSQNVLLITLITNTERRHPGFEATFFQLPRMSSCGGRLRKAQGT    281 - 350
FNSPYYPGHYPPNIDCTWNIEVPNNQHVKVRFKFFYLLEPGVPAGTCPKDYVEINGEKYCGERSQFVVTS    351 - 420
NSNKITVRFHSDQSYTDTGFLAEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDHSDELNCSCDA    421 - 490
GHQFTCKNKFCKPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSKSQQCNGKDDCGDGSDEASCP    491 - 560
KVNVVTCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDADEGEWPWQV    561 - 630
SLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQSQRSAPGVQERRLKRIISH    631 - 700
PFFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPAGKAIWVTGWGHTQYGGTGALILQKGEIRV    701 - 770
INQTTCENLLPQQITPRMMCVGFLSGGVDSCQGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYT    771 - 840
RLPLFRDWIKENTGV                                                           841 - 855
//

Text Mined References (106)

PMID Year Title
26513078 2015 Matriptase-1 expression is lost in psoriatic skin lesions and is downregulated by TNF? in vitro.
26157007 2016 Matriptase activation and shedding through PDGF-D-mediated extracellular acidosis.
25873032 2015 Targeting matriptase in breast cancer abrogates tumour progression via impairment of stromal-epithelial growth factor signalling.
25786220 2015 Differential subcellular localization renders HAI-2 a matriptase inhibitor in breast cancer cells but not in mammary epithelial cells.
25730905 2015 Androgen receptor non-nuclear regulation of prostate cancer cell invasion mediated by Src and matriptase.
24705933 2014 Matriptase autoactivation is tightly regulated by the cellular chemical environments.
24696092 2014 Potent and specific inhibition of the biological activity of the type-II transmembrane serine protease matriptase by the cyclic microprotein MCoTI-II.
24617769 2014 The HIV-1 gp41 ectodomain is cleaved by matriptase to produce a chemotactic peptide that acts through FPR2.
24382204 2014 Expression of matriptase correlates with tumour progression and clinical prognosis in oral squamous cell carcinoma.
24248283 2014 Overexpression of matriptase correlates with poor prognosis in esophageal squamous cell carcinoma.
More...